Solution Structure of the WNK1 Autoinhibitory Domain
GAMDPQEETG VRVELAEEDD GEKIAIKLWL RIEDIKKLKG KYKDNEAIEF SFDLERDVPE DVAQEMVESG YVCEGDHKTM AKAIKDRVSL IKRKREQR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.0 % (1141 of 1164) | 97.6 % (602 of 617) | 98.7 % (440 of 446) | 98.0 % (99 of 101) |
Backbone | 98.5 % (575 of 584) | 98.5 % (197 of 200) | 98.3 % (283 of 288) | 99.0 % (95 of 96) |
Sidechain | 97.9 % (658 of 672) | 97.1 % (405 of 417) | 99.6 % (249 of 250) | 80.0 % (4 of 5) |
Aromatic | 100.0 % (52 of 52) | 100.0 % (26 of 26) | 100.0 % (25 of 25) | 100.0 % (1 of 1) |
Methyl | 100.0 % (98 of 98) | 100.0 % (49 of 49) | 100.0 % (49 of 49) |
1. WNKAI
GAMDPQEETG VRVELAEEDD GEKIAIKLWL RIEDIKKLKG KYKDNEAIEF SFDLERDVPE DVAQEMVESG YVCEGDHKTM AKAIKDRVSL IKRKREQRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | WNKAI | [U-100% 13C; U-100% 15N] | 0.65 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18398_2lru.nef |
Input source #2: Coordindates | 2lru.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---480-------490-------500-------510-------520-------530-------540-------550-------560-------570-- GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR --------10--------20--------30--------40--------50--------60--------70--------80--------90--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 98 | 0 | 0 | 100.0 |
Content subtype: combined_18398_2lru.nef
Assigned chemical shifts
---480-------490-------500-------510-------520-------530-------540-------550-------560-------570-- GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 617 | 602 | 97.6 |
13C chemical shifts | 446 | 438 | 98.2 |
15N chemical shifts | 108 | 97 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 200 | 195 | 97.5 |
13C chemical shifts | 196 | 189 | 96.4 |
15N chemical shifts | 96 | 93 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 417 | 407 | 97.6 |
13C chemical shifts | 250 | 249 | 99.6 |
15N chemical shifts | 12 | 4 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 51 | 98.1 |
13C chemical shifts | 52 | 51 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 26 | 100.0 |
13C chemical shifts | 25 | 25 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---480-------490-------500-------510-------520-------530-------540-------550-------560-------570-- GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR
Dihedral angle restraints
---480-------490-------500-------510-------520-------530-------540-------550-------560-------570-- GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR ||| ||||||||||| |||||||||||||||| |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| ..MDP....GVRVELAEEDD..KIAIKLWLRIEDIKKL.GKYKDNEAIEFSFDLERD.PEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQ ---480-------490-------500-------510-------520-------530-------540-------550-------560-------570-