Solution structure of a ubiquitin-like protein from Trypanosoma brucei
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.6 % (705 of 984) | 76.6 % (392 of 512) | 61.5 % (235 of 382) | 86.7 % (78 of 90) |
Backbone | 78.1 % (392 of 502) | 90.8 % (157 of 173) | 64.2 % (158 of 246) | 92.8 % (77 of 83) |
Sidechain | 68.8 % (385 of 560) | 69.3 % (235 of 339) | 69.6 % (149 of 214) | 14.3 % (1 of 7) |
Aromatic | 0.0 % (0 of 54) | 0.0 % (0 of 27) | 0.0 % (0 of 27) | |
Methyl | 66.0 % (66 of 100) | 70.0 % (35 of 50) | 62.0 % (31 of 50) |
1. entity
HHHHHHMLLK VKTVSNKVIQ ITSLTDDNTI AELKGKLEES EGIPGNMIRL VYQGKQLEDE KRLKDYQMSA GATFHMVVAL RAGCSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | tbubl | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 0.5 mM | |
3 | D2O | natural abundance | 0.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18399_2lrw.nef |
Input source #2: Coordindates | 2lrw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------10--------20--------30--------40--------50--------60--------70-------- HHHHHHMLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHMLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC --------10--------20--------30--------40--------50--------60--------70--------80----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 84 | 0 | 0 | 100.0 |
Content subtype: combined_18399_2lrw.nef
Assigned chemical shifts
--------------10--------20--------30--------40--------50--------60--------70-------- HHHHHHMLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 512 | 377 | 73.6 |
13C chemical shifts | 382 | 224 | 58.6 |
15N chemical shifts | 93 | 77 | 82.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 173 | 157 | 90.8 |
13C chemical shifts | 168 | 77 | 45.8 |
15N chemical shifts | 83 | 77 | 92.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 339 | 220 | 64.9 |
13C chemical shifts | 214 | 147 | 68.7 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 35 | 64.8 |
13C chemical shifts | 54 | 31 | 57.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 0 | 0.0 |
13C chemical shifts | 27 | 0 | 0.0 |
Distance restraints
--------------10--------20--------30--------40--------50--------60--------70-------- HHHHHHMLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC
Dihedral angle restraints
--------------10--------20--------30--------40--------50--------60--------70-------- HHHHHHMLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC |||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| ||||||||| ......MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQ.EDEKRLKDYQ...GATFHMVVA --------------10--------20--------30--------40--------50--------60--------70---