RNA structural dynamics are modulated through anti-folding by chaperones
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.4 % (489 of 535) | 92.9 % (263 of 283) | 88.8 % (183 of 206) | 93.5 % (43 of 46) |
Backbone | 93.5 % (245 of 262) | 96.7 % (87 of 90) | 91.6 % (120 of 131) | 92.7 % (38 of 41) |
Sidechain | 90.1 % (283 of 314) | 91.2 % (176 of 193) | 87.9 % (102 of 116) | 100.0 % (5 of 5) |
Aromatic | 95.0 % (38 of 40) | 100.0 % (20 of 20) | 89.5 % (17 of 19) | 100.0 % (1 of 1) |
Methyl | 92.9 % (39 of 42) | 90.5 % (19 of 21) | 95.2 % (20 of 21) |
1. CTD-StpA
RQPRPAKYKF TDVNGETKTW TGQGRTPKPI AQALAEGKSL DDFLISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CTD-StpA | [U-99% 13C; U-99% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18400_2lrx.nef |
Input source #2: Coordindates | 2lrx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40----- RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI ||||||||||||||||||||||||||||||||||||||||||||| RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 45 | 0 | 0 | 100.0 |
Content subtype: combined_18400_2lrx.nef
Assigned chemical shifts
--------10--------20--------30--------40----- RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI ||||||||||||||||||||||||||||||||||||||||||||| RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 269 | 95.1 |
13C chemical shifts | 206 | 182 | 88.3 |
15N chemical shifts | 49 | 43 | 87.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 90 | 89 | 98.9 |
13C chemical shifts | 90 | 80 | 88.9 |
15N chemical shifts | 41 | 38 | 92.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 193 | 180 | 93.3 |
13C chemical shifts | 116 | 102 | 87.9 |
15N chemical shifts | 8 | 5 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 21 | 20 | 95.2 |
13C chemical shifts | 21 | 20 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 20 | 100.0 |
13C chemical shifts | 19 | 17 | 89.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40----- RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI ||||||||||||||||||||||||||||||||||||||||||||| RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI
Dihedral angle restraints
--------10--------20--------30--------40----- RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI |||||||||||||||||||||||||||||||||||||||||||| .QPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI