High Definition Solution Structure of PED/PEA-15 Death Effector Domain
MAEYGTLLQD LTNNITLEDL EQLKSACKED IPSEKSEEIT TGSAWFSFLE SHNKLDKDNL SYIEHIFEIS RRPDLLTMVV DYRTRVLKIS EEDELDTKLT RIPSAKKYKD IIRQPSEEEI IKLAPPPKKA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.1 % (1318 of 1567) | 84.6 % (697 of 824) | 80.7 % (494 of 612) | 96.9 % (127 of 131) |
Backbone | 83.2 % (637 of 766) | 95.3 % (243 of 255) | 70.9 % (275 of 388) | 96.7 % (119 of 123) |
Sidechain | 85.3 % (792 of 929) | 78.6 % (447 of 569) | 95.7 % (337 of 352) | 100.0 % (8 of 8) |
Aromatic | 100.0 % (82 of 82) | 100.0 % (41 of 41) | 100.0 % (40 of 40) | 100.0 % (1 of 1) |
Methyl | 96.0 % (144 of 150) | 96.0 % (72 of 75) | 96.0 % (72 of 75) |
1. pea-15
MAEYGTLLQD LTNNITLEDL EQLKSACKED IPSEKSEEIT TGSAWFSFLE SHNKLDKDNL SYIEHIFEIS RRPDLLTMVV DYRTRVLKIS EEDELDTKLT RIPSAKKYKD IIRQPSEEEI IKLAPPPKKASolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphoprotein enriched in astrocytes 15A | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18412_2ls7.nef |
Input source #2: Coordindates | 2ls7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_18412_2ls7.nef
Assigned chemical shifts
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKIS --------10--------20--------30--------40--------50--------60--------70--------80--------90
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE ||||||||||||| |||||||||||| | | ||||||||||| ||||||||| ||||||||||||||||| MAEYGTLLQDLTN...LEDLEQLKSACK....S...E....GSAWFSFLESH........SYIEHIFEI...PDLLTMVVDYRTRVLKI --------10--------20--------30--------40--------50--------60--------70--------80---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKIS --------10--------20--------30--------40--------50--------60--------70--------80--------90
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE ||||||||||| ||||||||||| |||||| |||||||||| ||||||||| |||||||||||||||| .AEYGTLLQDLT....LEDLEQLKSAC.....SEKSEE...GSAWFSFLES.........SYIEHIFEI....DLLTMVVDYRTRVLKI --------10--------20--------30--------40--------50--------60--------70--------80---------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE ||||||||||| ||||||||||| |||||| |||||||||| ||||||||| |||||||||||||||| .AEYGTLLQDLT....LEDLEQLKSAC.....SEKSEE...GSAWFSFLES.........SYIEHIFEI....DLLTMVVDYRTRVLKI --------10--------20--------30--------40--------50--------60--------70--------80---------