Solution NMR Structure of De Novo Designed Four Helix Bundle Protein, Northeast Structural Genomics Consortium (NESG) Target OR188
MQEERKKLLE KLEKILDEVT DGAPDEARER IEKLAKDVKD ELEEGDAKNM IEKFRDEMEQ MYKDAPNAVM EQLLEEIEKL LKKAGSLVPR GSYLEHHHHH H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.1 % (1126 of 1222) | 90.9 % (592 of 651) | 93.6 % (438 of 468) | 93.2 % (96 of 103) |
Backbone | 93.7 % (562 of 600) | 90.6 % (184 of 203) | 96.0 % (287 of 299) | 92.9 % (91 of 98) |
Sidechain | 91.0 % (654 of 719) | 91.1 % (408 of 448) | 90.6 % (241 of 266) | 100.0 % (5 of 5) |
Aromatic | 40.0 % (20 of 50) | 52.0 % (13 of 25) | 28.0 % (7 of 25) | |
Methyl | 97.9 % (94 of 96) | 95.8 % (46 of 48) | 100.0 % (48 of 48) |
1. OR188
MQEERKKLLE KLEKILDEVT DGAPDEARER IEKLAKDVKD ELEEGDAKNM IEKFRDEMEQ MYKDAPNAVM EQLLEEIEKL LKKAGSLVPR GSYLEHHHHH HSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.3 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | OR188.001 | [U-10% 13C; U-100% 15N] | 1.3 mg/mL | |
7 | phosphate | natural abundance | 100 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 600MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 600MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 600MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 23.8 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR188.001 | [U-100% 13C; U-100% 15N] | 23.8 mg/mL | |
2 | phosphate | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.3 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | OR188.001 | [U-10% 13C; U-100% 15N] | 1.3 mg/mL | |
7 | phosphate | natural abundance | 100 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.3 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | OR188.001 | [U-10% 13C; U-100% 15N] | 1.3 mg/mL | |
7 | phosphate | natural abundance | 100 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz 750MHz Inova Cold Probe at Statler, UB
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.3 mg/mL OR188.001, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | OR188.001 | [U-10% 13C; U-100% 15N] | 1.3 mg/mL | |
7 | phosphate | natural abundance | 100 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18429_2lse.nef |
Input source #2: Coordindates | 2lse.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHH - H | H
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_18429_2lse.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHH --------10--------20--------30--------40--------50--------60--------70--------80--------90------- - H
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 651 | 611 | 93.9 |
13C chemical shifts | 468 | 435 | 92.9 |
15N chemical shifts | 108 | 95 | 88.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 203 | 190 | 93.6 |
13C chemical shifts | 202 | 191 | 94.6 |
15N chemical shifts | 98 | 90 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 448 | 421 | 94.0 |
13C chemical shifts | 266 | 244 | 91.7 |
15N chemical shifts | 10 | 5 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 53 | 100.0 |
13C chemical shifts | 53 | 53 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 13 | 52.0 |
13C chemical shifts | 25 | 7 | 28.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLE --------10--------20--------30--------40--------50--------60--------70--------80--------90----- - H
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHH |||||||||||||||||| |||||||||||||||||| |||||||||||||||||| ||||||||||||||||| ...ERKKLLEKLEKILDEVTD....EARERIEKLAKDVKDELE...AKNMIEKFRDEMEQMYKD...AVMEQLLEEIEKLLKKA --------10--------20--------30--------40--------50--------60--------70--------80---- - H