Solution structure of the mouse Rev1 C-terminal domain
GSGGFRPAAP NLAGAVEFSD VKTLLKEWIT TISDPMEEDI LQVVRYCTDL IEEKDLEKLD LVIKYMKRLM QQSVESVWNM AFDFILDNVQ VVLQQTYGST LKVT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.6 % (1109 of 1238) | 96.9 % (619 of 639) | 79.5 % (387 of 487) | 92.0 % (103 of 112) |
Backbone | 83.5 % (516 of 618) | 95.7 % (201 of 210) | 72.0 % (221 of 307) | 93.1 % (94 of 101) |
Sidechain | 96.1 % (691 of 719) | 97.4 % (418 of 429) | 94.6 % (264 of 279) | 81.8 % (9 of 11) |
Aromatic | 85.2 % (75 of 88) | 100.0 % (44 of 44) | 69.0 % (29 of 42) | 100.0 % (2 of 2) |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. entity
GSGGFRPAAP NLAGAVEFSD VKTLLKEWIT TISDPMEEDI LQVVRYCTDL IEEKDLEKLD LVIKYMKRLM QQSVESVWNM AFDFILDNVQ VVLQQTYGST LKVTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1 | [U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1 | [U-100% 13C; U-100% 15N] | 1 mM | |
18 | sodium phosphate | natural abundance | 25 mM | |
19 | potassium chloride | natural abundance | 100 mM | |
20 | DTT | natural abundance | 10 mM | |
21 | PMSF | natural abundance | 1 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1 | [U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1 | [U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1 | [U-100% 13C; U-100% 15N] | 1 mM | |
18 | sodium phosphate | natural abundance | 25 mM | |
19 | potassium chloride | natural abundance | 100 mM | |
20 | DTT | natural abundance | 10 mM | |
21 | PMSF | natural abundance | 1 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1 | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
10 | sodium phosphate | natural abundance | 25 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | PMSF | natural abundance | 1 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1 | [U-100% 13C; U-100% 15N] | 1 mM | |
18 | sodium phosphate | natural abundance | 25 mM | |
19 | potassium chloride | natural abundance | 100 mM | |
20 | DTT | natural abundance | 10 mM | |
21 | PMSF | natural abundance | 1 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1 | [U-100% 13C; U-100% 15N] | 1 mM | |
18 | sodium phosphate | natural abundance | 25 mM | |
19 | potassium chloride | natural abundance | 100 mM | |
20 | DTT | natural abundance | 10 mM | |
21 | PMSF | natural abundance | 1 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1 | [U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18431_2lsg.nef |
Input source #2: Coordindates | 2lsg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST ---- LKVT |||| LKVT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 104 | 0 | 0 | 100.0 |
Content subtype: combined_18431_2lsg.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST ---- LKVT |||| LKVT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 639 | 618 | 96.7 |
13C chemical shifts | 487 | 363 | 74.5 |
15N chemical shifts | 115 | 100 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 200 | 95.2 |
13C chemical shifts | 208 | 102 | 49.0 |
15N chemical shifts | 101 | 91 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 429 | 418 | 97.4 |
13C chemical shifts | 279 | 261 | 93.5 |
15N chemical shifts | 14 | 9 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 73 | 98.6 |
13C chemical shifts | 74 | 73 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 44 | 100.0 |
13C chemical shifts | 42 | 27 | 64.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST ---- LKVT |||| LKVT
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST |||||| ||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....FRPAAP......EFSDVKTLLKEWITTIS.PMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGST ---- LKVT |||| LKVT