Solution structure of the mouse Rev1 CTD in complex with the Rev1-interacting Region (RIR)of Pol Kappa
GSGGGAQDLS SLLPGQSSCF RPAAPNLAGA VEFSDVKTLL KEWITTISDP MEEDILQVVR YCTDLIEEKD LEKLDLVIKY MKRLMQQSVE SVWNMAFDFI LDNVQVVLQQ TYGSTLKVT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.9 % (1417 of 1689) | 90.4 % (794 of 878) | 74.7 % (490 of 656) | 85.8 % (133 of 155) |
Backbone | 78.0 % (668 of 856) | 88.3 % (257 of 291) | 68.0 % (289 of 425) | 87.1 % (122 of 140) |
Sidechain | 90.4 % (877 of 970) | 91.5 % (537 of 587) | 89.4 % (329 of 368) | 73.3 % (11 of 15) |
Aromatic | 79.3 % (92 of 116) | 93.1 % (54 of 58) | 64.3 % (36 of 56) | 100.0 % (2 of 2) |
Methyl | 97.5 % (156 of 160) | 97.5 % (78 of 80) | 97.5 % (78 of 80) |
1. entity 1
GSGGGAQDLS SLLPGQSSCF RPAAPNLAGA VEFSDVKTLL KEWITTISDP MEEDILQVVR YCTDLIEEKD LEKLDLVIKY MKRLMQQSVE SVWNMAFDFI LDNVQVVLQQ TYGSTLKVT2. entity 2
SHMSHKKSFF DKKRSERISN CQDTSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1_CTD | [U-100% 15N] | 0.7 ~ 1.0 mM | |
2 | RIR | [U-100% 15N] | 0.7 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
18 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
19 | sodium phosphate | natural abundance | 25 mM | |
20 | potassium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1_CTD | [U-100% 15N] | 0.7 ~ 1.0 mM | |
2 | RIR | [U-100% 15N] | 0.7 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
18 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
19 | sodium phosphate | natural abundance | 25 mM | |
20 | potassium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
18 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
19 | sodium phosphate | natural abundance | 25 mM | |
20 | potassium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rev1_CTD | [U-100% 15N] | 0.7 ~ 1.0 mM | |
2 | RIR | [U-100% 15N] | 0.7 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
18 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
19 | sodium phosphate | natural abundance | 25 mM | |
20 | potassium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
10 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | EDTA | natural abundance | 1 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Rev1_CTD | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
18 | RIR | [U-100% 13C; U-100% 15N] | 0.7 ~ 1.0 mM | |
19 | sodium phosphate | natural abundance | 25 mM | |
20 | potassium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | EDTA | natural abundance | 1 mM | |
23 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18433_2lsj.nef |
Input source #2: Coordindates | 2lsj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSGGGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI -------110--------- LDNVQVVLQQTYGSTLKVT ||||||||||||||||||| LDNVQVVLQQTYGSTLKVT
-------210-------220----- SHMSHKKSFFDKKRSERISNCQDTS ||||||||||||||||||||||||| SHMSHKKSFFDKKRSERISNCQDTS --------10--------20-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
B | B | 25 | 0 | 0 | 100.0 |
Content subtype: combined_18433_2lsj.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI |||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....GAQDLSSLLPGQ..CFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI -------110--------- LDNVQVVLQQTYGSTLKVT ||||||||||||||||||| LDNVQVVLQQTYGSTLKVT
-------210-------220----- SHMSHKKSFFDKKRSERISNCQDTS | ||||||||||||||||||| ....H.KSFFDKKRSERISNCQDTS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 716 | 679 | 94.8 |
13C chemical shifts | 543 | 397 | 73.1 |
15N chemical shifts | 131 | 115 | 87.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 241 | 221 | 91.7 |
13C chemical shifts | 238 | 113 | 47.5 |
15N chemical shifts | 115 | 104 | 90.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 475 | 458 | 96.4 |
13C chemical shifts | 305 | 284 | 93.1 |
15N chemical shifts | 16 | 11 | 68.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 79 | 97.5 |
13C chemical shifts | 81 | 79 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 43 | 97.7 |
13C chemical shifts | 42 | 27 | 64.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 162 | 117 | 72.2 |
13C chemical shifts | 113 | 63 | 55.8 |
15N chemical shifts | 29 | 17 | 58.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 37 | 74.0 |
13C chemical shifts | 50 | 20 | 40.0 |
15N chemical shifts | 25 | 17 | 68.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 112 | 80 | 71.4 |
13C chemical shifts | 63 | 43 | 68.3 |
15N chemical shifts | 4 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 4 | 3 | 75.0 |
13C chemical shifts | 4 | 3 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 11 | 78.6 |
13C chemical shifts | 14 | 7 | 50.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI |||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......QDLSSLLP.Q..CFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI -------110--------- LDNVQVVLQQTYGSTLKVT ||||||||||||||||||| LDNVQVVLQQTYGSTLKVT
-------210-------220----- SHMSHKKSFFDKKRSERISNCQDTS | ||||||||||||| | | ....H.KSFFDKKRSERIS.C..T -------210-------220----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGGGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| .......DLS.........FRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQS.ESVWNMAFDFI -------110--------- LDNVQVVLQQTYGSTLKVT ||||||||||||||||||| LDNVQVVLQQTYGSTLKVT
-------210-------220----- SHMSHKKSFFDKKRSERISNCQDTS ||||||||||||||||| .....KKSFFDKKRSERISNCQ -------210-------220--