Solution structure of the C-terminal domain of Tetrahymena telomerase protein p65
MHHHHHHSVS IDVEIKQNCL IKIINIPQGT LKAEVVLAVR HLGYEFYCDY IDENSNQINS NLIQQDQHPQ LNDLLKEGQA MIRFQNSDEQ RLAIQKLLNH NNNKLQIEIR GQICDVISTI PEDEEKNYWN YIKFKKN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.4 % (1358 of 1689) | 77.5 % (689 of 889) | 85.1 % (542 of 637) | 77.9 % (127 of 163) |
Backbone | 91.7 % (748 of 816) | 90.9 % (250 of 275) | 92.4 % (376 of 407) | 91.0 % (122 of 134) |
Sidechain | 72.9 % (733 of 1006) | 71.5 % (439 of 614) | 79.6 % (289 of 363) | 17.2 % (5 of 29) |
Aromatic | 29.7 % (35 of 118) | 35.6 % (21 of 59) | 22.4 % (13 of 58) | 100.0 % (1 of 1) |
Methyl | 88.2 % (134 of 152) | 86.8 % (66 of 76) | 89.5 % (68 of 76) |
1. entity
MHHHHHHSVS IDVEIKQNCL IKIINIPQGT LKAEVVLAVR HLGYEFYCDY IDENSNQINS NLIQQDQHPQ LNDLLKEGQA MIRFQNSDEQ RLAIQKLLNH NNNKLQIEIR GQICDVISTI PEDEEKNYWN YIKFKKNSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | p65 | natural abundance | 1 mM | |
9 | D2O | [U-100% 2H] | 100 % | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | p65 | natural abundance | 1 mM | |
9 | D2O | [U-100% 2H] | 100 % | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | p65 | natural abundance | 1 mM | |
9 | D2O | [U-100% 2H] | 100 % | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | p65 | natural abundance | 1 mM | |
9 | D2O | [U-100% 2H] | 100 % | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p65 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.01 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18435_2lsl.nef |
Input source #2: Coordindates | 2lsl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------370-------380-------390-------400-------410-------420-----450-------460-------470-------480-- MHHHHHHSVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINSNLIQQDQHPQLNDLLKEGQAMIRFQNSDEQRLAIQKLLNH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHSVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINSNLIQQDQHPQLNDLLKEGQAMIRFQNSDEQRLAIQKLLNH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----490-------500-------510--------- NNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN ||||||||||||||||||||||||||||||||||||| NNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN -------110-------120-------130-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 137 | 0 | 0 | 100.0 |
Content subtype: combined_18435_2lsl.nef
Assigned chemical shifts
-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460 .......SVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINS......................NLIQQDQHPQLNDLLKEG ||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .......SVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINS......................NLIQQDQHPQLNDLLKEG -------470-------480-------490-------500-------510--------- QAMIRFQNSDEQRLAIQKLLN...NKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN ||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| QAMIRFQNSDEQRLAIQKLLN...NKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 889 | 666 | 74.9 |
13C chemical shifts | 637 | 532 | 83.5 |
15N chemical shifts | 167 | 121 | 72.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 275 | 247 | 89.8 |
13C chemical shifts | 274 | 253 | 92.3 |
15N chemical shifts | 134 | 120 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 614 | 419 | 68.2 |
13C chemical shifts | 363 | 279 | 76.9 |
15N chemical shifts | 33 | 1 | 3.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 65 | 83.3 |
13C chemical shifts | 78 | 62 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 15 | 25.4 |
13C chemical shifts | 58 | 11 | 19.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460 .......SVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINS......................NLIQQDQHPQLNDLLKEG ||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .......SVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINS......................NLIQQDQHPQLNDLLKEG -------470-------480-------490-------500-------510--------- QAMIRFQNSDEQRLAIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QAMIRFQNSDEQRLAIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN
Dihedral angle restraints
-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460 .......SVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINS......................NLIQQDQHPQLNDLLKEG ||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .......SVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINS......................NLIQQDQHPQLNDLLKEG -------470-------480-------490-------500-------510-------- QAMIRFQNSDEQRLAIQKLLN..NNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKK ||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| QAMIRFQNSDEQRLAIQKLLN..NNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKK
RDC restraints
-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460 ........VSIDVEIKQNCLIKIINI.QGTLKAEVVLAVRHLGYEFY.DYIDENSNQINS......................NLIQQDQH.QLNDLLKEG |||||||||||||||||| |||||||||||||||||||| |||||||||||| |||||||| ||||||||| ........VSIDVEIKQNCLIKIINI.QGTLKAEVVLAVRHLGYEFY.DYIDENSNQINS......................NLIQQDQH.QLNDLLKEG -------470-------480-------490-------500-------510--------- .AMIRF.NSDEQRLAIQKL........QIEIRGQICDVISTI.EDEEKNYWNYIKFKKN ||||| |||||||||||| ||||||||||||||| |||||||||||||||| .AMIRF.NSDEQRLAIQKL........QIEIRGQICDVISTI.EDEEKNYWNYIKFKKN