BMRBj - BMREntryMaster

Found 1 Document (7.299 seconds)

BMRB: 18438

2LSO

Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A

Authors

Eletsky, A., Lee, H., Lee, D., Kohan, E., Janjua, H., Xiao, R., Acton, T.B., Everett, J.K., Montelione, G.T., Prestegard, J.H., Szyperski, T.

Assembly

HR7057A

Entity

1. HR7057A (polymer, Thiol state: not present), 83 monomers, 9384.650 Da Detail

SHMQPGKYSQ LVVETIRRLG ERNGSSLAKI YTEAKKVPWF DQQNGRTYLK YSIKALVQND TLLQVKGTGA NGSFKLNRKK LEG

Formula weight

9384.65 Da

Source organism

Homo sapiens

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 97.6 %, Completeness: 96.7 %, Completeness (bb): 95.7 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	96.7 % (972 of 1005)	96.6 % (513 of 531)	97.6 % (372 of 381)	93.5 % (87 of 93)
Backbone	95.7 % (473 of 494)	95.3 % (164 of 172)	97.1 % (234 of 241)	92.6 % (75 of 81)
Sidechain	97.6 % (572 of 586)	97.2 % (349 of 359)	98.1 % (211 of 215)	100.0 % (12 of 12)
Aromatic	94.1 % (64 of 68)	94.1 % (32 of 34)	93.9 % (31 of 33)	100.0 % (1 of 1)
Methyl	100.0 % (86 of 86)	100.0 % (43 of 43)	100.0 % (43 of 43)

1. HR7057A

SHMQPGKYSQ LVVETIRRLG ERNGSSLAKI YTEAKKVPWF DQQNGRTYLK YSIKALVQND TLLQVKGTGA NGSFKLNRKK LEG

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.6 mM [5% 13C; U-100% 15N]-HR7057A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
9	HR7057A.011	[5% 13C; U-100% 15N]	0.6 mM
10	MES	natural abundance	20 mM
11	sodium chloride	natural abundance	100 mM
12	calcium chloride	natural abundance	5 mM
13	DSS	natural abundance	50 uM
14	sodium azide	natural abundance	0.02 %
15	H2O	natural abundance	90 %
16	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.3 mM [5% 13C; U-100% 15N]-HR7057A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
17	HR7057A.011	[5% 13C; U-100% 15N]	0.3 mM
18	MES	natural abundance	20 mM
19	sodium chloride	natural abundance	100 mM
20	calcium chloride	natural abundance	5 mM
21	DSS	natural abundance	50 uM
22	sodium azide	natural abundance	0.02 %
23	C12E5 PEG	natural abundance	4 %
24	hexanol	natural abundance	4 %
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.1 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.1 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.02 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.28 ppm, Outliers: 4 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LSO, Strand ID: A Detail

Release date

2012-06-05

Related entities 1. HR7057A, : 1 : 2 : 153 entities Detail

Interaction partners 1. HR7057A, : 104 interactors Detail

More details for 104 interactors identified by 21 citations

Experiments performed 19 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

2 2D 1H-13C CT-HSQC aliphatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

3 3D HNCO

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

4 3D CBCA(CO)NH

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

5 3D HNCACB

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

6 3D (H)CCH-TOCSY aliphatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

7 3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

8 2D 1H-13C CT-HSQC aromatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

9 3D (H)C(CCO)NH-TOCSY

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

10 3D H(CCCO)NH-TOCSY

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

11 3D HBHA(CO)NH

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

12 3D HN(CA)CO

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

13 3D HCCH-COSY aliphatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

14 3D HCCH-COSY aromatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

15 2D 1H-13C CT-HSQC methyl

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.6 mM [5% 13C; U-100% 15N]-HR7057A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
9	HR7057A.011	[5% 13C; U-100% 15N]	0.6 mM
10	MES	natural abundance	20 mM
11	sodium chloride	natural abundance	100 mM
12	calcium chloride	natural abundance	5 mM
13	DSS	natural abundance	50 uM
14	sodium azide	natural abundance	0.02 %
15	H2O	natural abundance	90 %
16	D2O	natural abundance	10 %

16 2D J-resolved 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.6 mM [5% 13C; U-100% 15N]-HR7057A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
9	HR7057A.011	[5% 13C; U-100% 15N]	0.6 mM
10	MES	natural abundance	20 mM
11	sodium chloride	natural abundance	100 mM
12	calcium chloride	natural abundance	5 mM
13	DSS	natural abundance	50 uM
14	sodium azide	natural abundance	0.02 %
15	H2O	natural abundance	90 %
16	D2O	natural abundance	10 %

17 2D J-resolved 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.3 mM [5% 13C; U-100% 15N]-HR7057A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
17	HR7057A.011	[5% 13C; U-100% 15N]	0.3 mM
18	MES	natural abundance	20 mM
19	sodium chloride	natural abundance	100 mM
20	calcium chloride	natural abundance	5 mM
21	DSS	natural abundance	50 uM
22	sodium azide	natural abundance	0.02 %
23	C12E5 PEG	natural abundance	4 %
24	hexanol	natural abundance	4 %
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

18 1D 15N T1

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

19 1D 15N T2

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM HR7057A.011, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7057A.011	[U-100% 13C; U-100% 15N]	0.9 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	calcium chloride	natural abundance	5 mM
5	DSS	natural abundance	50 uM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_18438_2lso.nef
Input source #2: Coordindates	2lso.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80---
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	83	0	0	100.0

Content subtype: combined_18438_2lso.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	975		97.6 (chain: A, length: 83)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	2062 (1)	noe	96.4 (chain: A, length: 83)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_3	OK	76 (76)	.	59.0 (chain: A, length: 83)
1	RDC restraints	CNS/XPLOR_dipolar_coupling_4	OK	41 (41)	.	49.4 (chain: A, length: 83)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 83, Sequence coverage: 97.6%
- Total number of assignments
  - ¹H chemical shifts: 515
  - ¹³C chemical shifts: 372
  - ¹⁵N chemical shifts: 88
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
15	THR	HG1	5.31
25	SER	HG	7.638

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	531	513	96.6
¹³C chemical shifts	381	372	97.6
¹⁵N chemical shifts	98	88	89.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	172	164	95.3
¹³C chemical shifts	166	161	97.0
¹⁵N chemical shifts	81	75	92.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	359	349	97.2
¹³C chemical shifts	215	211	98.1
¹⁵N chemical shifts	17	13	76.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	44	100.0
¹³C chemical shifts	44	44	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	34	32	94.1
¹³C chemical shifts	33	31	93.9
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 83, Sequence coverage: 96.4%
- Total number of restraints: 2056
- Weight of restraints: 1.0 (2056)
- Potential type of restraints: square-well-parabolic (2056)
- Range of distance target values: 1.27, 2.89 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 83, Sequence coverage: 59.0%
- Total number of restraints: 76
- Total number of restraints per polymer type: 76
- Weight of restraints: 1.0 (76)
- Potential type of restraints: square-well-parabolic (76)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

RDC restraints

Saveframe: CNS/XPLOR_dipolar_coupling_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 83, Sequence coverage: 49.4%
- Total number of restraints: 41
- Potential type of restraints: undefined (41)
- Range of observed RDC values: 100.0, -100.0 (Hz)
- RDC restraints per residue

Keywords NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein NMR, Protein Structure Initiative, Structural Genomics, Target HR7057A

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (7.299 seconds)

BMRB: 18438

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. HR7057A, : 1 : 2 : 153 entities Detail

Interaction partners 1. HR7057A, : 104 interactors Detail

Experiments performed 19 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail