Solution structure of a thioredoxin from Thermus thermophilus
MSLRWYPYPE ALALAQAHGR MVMVYFHSEH CPYCQQMNTF VLSDPGVSRL LEARFVVASV SVDTPEGQEL ARRYRVPGTP TFVFLVPKAG AWEEVGRLFG SRPRAEFLKE LRQVCVKGGA CGEGHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.3 % (1380 of 1512) | 90.7 % (711 of 784) | 91.7 % (549 of 599) | 93.0 % (120 of 129) |
Backbone | 93.0 % (709 of 762) | 93.1 % (244 of 262) | 93.1 % (353 of 379) | 92.6 % (112 of 121) |
Sidechain | 90.3 % (785 of 869) | 89.5 % (467 of 522) | 91.4 % (310 of 339) | 100.0 % (8 of 8) |
Aromatic | 82.9 % (141 of 170) | 83.5 % (71 of 85) | 81.9 % (68 of 83) | 100.0 % (2 of 2) |
Methyl | 100.0 % (130 of 130) | 100.0 % (65 of 65) | 100.0 % (65 of 65) |
1. thioredoxin
MSLRWYPYPE ALALAQAHGR MVMVYFHSEH CPYCQQMNTF VLSDPGVSRL LEARFVVASV SVDTPEGQEL ARRYRVPGTP TFVFLVPKAG AWEEVGRLFG SRPRAEFLKE LRQVCVKGGA CGEGHHHHHHSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 303 K, pH 5.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 5.8, 5mM DTT, 1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-13C; U-15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18443_2lst.nef |
Input source #2: Coordindates | 2lst.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG -------110-------120-------130 SRPRAEFLKELRQVCVKGGACGEGHHHHHH |||||||||||||||||||||||||||||| SRPRAEFLKELRQVCVKGGACGEGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_18443_2lst.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 SRPRAEFLKELRQVCVKGGACGEGHHHHHH ||||||||||||||||||||||||| SRPRAEFLKELRQVCVKGGACGEGH -------110-------120-----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 784 | 712 | 90.8 |
13C chemical shifts | 599 | 547 | 91.3 |
15N chemical shifts | 140 | 121 | 86.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 262 | 246 | 93.9 |
13C chemical shifts | 260 | 238 | 91.5 |
15N chemical shifts | 121 | 112 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 522 | 466 | 89.3 |
13C chemical shifts | 339 | 309 | 91.2 |
15N chemical shifts | 19 | 9 | 47.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 68 | 98.6 |
13C chemical shifts | 69 | 68 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 70 | 82.4 |
13C chemical shifts | 83 | 68 | 81.9 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..LRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 SRPRAEFLKELRQVCVKGGACGEGHHHHHH |||||||||||||||||||||||| SRPRAEFLKELRQVCVKGGACGEG -------110-------120----
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG | |||||||||| ||||||| | || ||| || |||||| | | ||||||||| |||||| | | | || | ...R.YPYPEALALA.....MVMVYFH............F...DP.VSR.LE..FVVASV.V.T.EGQELARRY......TFVFLV.K..A.E.VG.L.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 SRPRAEFLKELRQVCVKGGACGEGHHHHHH |||||||||||| ..PRAEFLKELRQV -------110----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFG |||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ||||||||||||| ||||||||||| |||||||||| .SLRWYPYPEALALAQAHGRMVMVYFHSE..PYCQQMNTFVLSDPGVSRLLEARFVVASVSV.TPEGQELARRYRV..TPTFVFLVPKA.AWEEVGRLFG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 SRPRAEFLKELRQVCVKGGACGEGHHHHHH |||||||||||||||||| .RPRAEFLKELRQVCVKGG -------110---------