BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	77.5 % (341 of 440)	85.2 % (202 of 237)	62.1 % (105 of 169)	100.0 % (34 of 34)
Backbone	99.0 % (206 of 208)	97.3 % (71 of 73)	100.0 % (101 of 101)	100.0 % (34 of 34)
Sidechain	63.1 % (166 of 263)	79.9 % (131 of 164)	35.4 % (35 of 99)
Aromatic	46.2 % (12 of 26)	92.3 % (12 of 13)	0.0 % (0 of 13)
Methyl	50.0 % (15 of 30)	86.7 % (13 of 15)	13.3 % (2 of 15)

1. SBM

SKKEKKKGPE KTDEYLLARF KGDGVKYKAK LIGID

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 15N-SBM

#	Name	Isotope labeling	Concentration
1	DSS	[U-2H]	50 uM
2	potassium chloride	natural abundance	40 mM
3	sodium azide	natural abundance	1 mM
4	citric	[U-99% 2H]	10 mM
5	SBM	natural abundance	1 mM

Sample #2

Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details unlabelled-SBM

#	Name	Isotope labeling	Concentration
6	DSS	[U-2H]	50 uM
7	potassium chloride	natural abundance	40 mM
8	sodium azide	natural abundance	1 mM
9	citric	[U-99% 2H]	10 mM
10	SBM	natural abundance	1 mM

Sample #3

Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 13C,15N-SBM

#	Name	Isotope labeling	Concentration
11	DSS	[U-2H]	50 uM
12	potassium chloride	natural abundance	40 mM
13	sodium azide	natural abundance	1 mM
14	citric	[U-99% 2H]	10 mM
15	SBM	natural abundance	1 mM

Protein Blocks Logo

Calculated from 20 models in PDB: 2LSW, Strand ID: A Detail

Release date

2012-09-16

Citation

Structure, sulfatide binding properties, and inhibition of platelet aggregation by a disabled-2 protein-derived peptide
Xiao, S., Charonko, J.J., Fu, X., Salmanzadeh, A., Davalos, R.V., Vlachos, P.P., Finkielstein, C.V., Capelluto, D.G.S.
J. Biol. Chem. (2012), 287, 37691-37702, PubMed 22977233 , DOI 10.1074/jbc.M112.385609 , Abstract

Related entities 1. SBM, : 1 : 2 : 4 : 13 entities Detail

Interaction partners 1. SBM, : 52 interactors Detail

More details for 52 interactors identified by 18 citations

Experiments performed 7 experiments Detail

1 3D HN(CA)CO

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 13C,15N-SBM

#	Name	Isotope labeling	Concentration
11	DSS	[U-2H]	50 uM
12	potassium chloride	natural abundance	40 mM
13	sodium azide	natural abundance	1 mM
14	citric	[U-99% 2H]	10 mM
15	SBM	natural abundance	1 mM

2 3D HNCO

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 13C,15N-SBM

#	Name	Isotope labeling	Concentration
11	DSS	[U-2H]	50 uM
12	potassium chloride	natural abundance	40 mM
13	sodium azide	natural abundance	1 mM
14	citric	[U-99% 2H]	10 mM
15	SBM	natural abundance	1 mM

3 3D HNCACB

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 13C,15N-SBM

#	Name	Isotope labeling	Concentration
11	DSS	[U-2H]	50 uM
12	potassium chloride	natural abundance	40 mM
13	sodium azide	natural abundance	1 mM
14	citric	[U-99% 2H]	10 mM
15	SBM	natural abundance	1 mM

4 3D CBCA(CO)NH

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 13C,15N-SBM

#	Name	Isotope labeling	Concentration
11	DSS	[U-2H]	50 uM
12	potassium chloride	natural abundance	40 mM
13	sodium azide	natural abundance	1 mM
14	citric	[U-99% 2H]	10 mM
15	SBM	natural abundance	1 mM

5 3D 1H-15N NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details 15N-SBM

#	Name	Isotope labeling	Concentration
1	DSS	[U-2H]	50 uM
2	potassium chloride	natural abundance	40 mM
3	sodium azide	natural abundance	1 mM
4	citric	[U-99% 2H]	10 mM
5	SBM	natural abundance	1 mM

6 2D 1H-1H TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details unlabelled-SBM

#	Name	Isotope labeling	Concentration
6	DSS	[U-2H]	50 uM
7	potassium chloride	natural abundance	40 mM
8	sodium azide	natural abundance	1 mM
9	citric	[U-99% 2H]	10 mM
10	SBM	natural abundance	1 mM

7 2D 1H-1H NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5, Details unlabelled-SBM

#	Name	Isotope labeling	Concentration
6	DSS	[U-2H]	50 uM
7	potassium chloride	natural abundance	40 mM
8	sodium azide	natural abundance	1 mM
9	citric	[U-99% 2H]	10 mM
10	SBM	natural abundance	1 mM

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18449_2lsw.nef
Input source #2: Coordindates	2lsw.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-20-------30--------40--------50--------
GPLGSSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGID
||||||||||||||||||||||||||||||||||||||||
GPLGSSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGID
--------10--------20--------30--------40

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	40	0	0	100.0

Content subtype: combined_18449_2lsw.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	340		87.5 (chain: A, length: 40)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	793 (1)	noe	87.5 (chain: A, length: 40)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_3	OK	36 (36)	.	55.0 (chain: A, length: 40)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 40, Sequence coverage: 87.5%
- Total number of assignments
  - ¹H chemical shifts: 205
  - ¹³C chemical shifts: 101
  - ¹⁵N chemical shifts: 34
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	261	205	78.5
¹³C chemical shifts	187	101	54.0
¹⁵N chemical shifts	39	34	87.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	84	73	86.9
¹³C chemical shifts	80	70	87.5
¹⁵N chemical shifts	38	34	89.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	177	132	74.6
¹³C chemical shifts	107	31	29.0
¹⁵N chemical shifts	1	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	17	14	82.4
¹³C chemical shifts	17	2	11.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	13	12	92.3
¹³C chemical shifts	13	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 40, Sequence coverage: 87.5%
- Total number of restraints: 793
- Weight of restraints: 1.0 (793)
- Potential type of restraints: square-well-parabolic (793)
- Range of distance target values: 2.25, 3.9 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 40, Sequence coverage: 55.0%
- Total number of restraints: 36
- Total number of restraints per polymer type: 36
- Weight of restraints: 1.0 (36)
- Potential type of restraints: square-well-parabolic (36)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords peptide

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (2.876 seconds)

BMRB: 18449

Sample #1

Sample #2

Sample #3

Related entities 1. SBM, : 1 : 2 : 4 : 13 entities Detail

Interaction partners 1. SBM, : 52 interactors Detail

Experiments performed 7 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail