Structure of the C-terminal domain from human REV1
GNLAGAVEFN DVKTLLREWI TTISDPMEED ILQVVKYCTD LIEEKDLEKL DLVIKYMKRL MQQSVESVWN MAFDFILDNV QVVLQQTYGS TLKVT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.6 % (1030 of 1150) | 90.4 % (536 of 593) | 86.9 % (392 of 451) | 96.2 % (102 of 106) |
Backbone | 95.2 % (541 of 568) | 95.3 % (183 of 192) | 95.0 % (268 of 282) | 95.7 % (90 of 94) |
Sidechain | 85.6 % (577 of 674) | 88.0 % (353 of 401) | 81.2 % (212 of 261) | 100.0 % (12 of 12) |
Aromatic | 55.1 % (43 of 78) | 66.7 % (26 of 39) | 40.5 % (15 of 37) | 100.0 % (2 of 2) |
Methyl | 88.2 % (120 of 136) | 88.2 % (60 of 68) | 88.2 % (60 of 68) |
1. entity
GNLAGAVEFN DVKTLLREWI TTISDPMEED ILQVVKYCTD LIEEKDLEKL DLVIKYMKRL MQQSVESVWN MAFDFILDNV QVVLQQTYGS TLKVTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | REV1-CT | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 0.25 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | [U-2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18455_2lsy.nef |
Input source #2: Coordindates | 2lsy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---1160---1170------1180------1190------1200------1210------1220------1230------1240------1250- GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT --------10--------20--------30--------40--------50--------60--------70--------80--------90-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 95 | 0 | 0 | 100.0 |
Content subtype: combined_18455_2lsy.nef
Assigned chemical shifts
---1160---1170------1180------1190------1200------1210------1220------1230------1240------1250- GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NLAGAVEFNDVKTLLREWITTI..PMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 593 | 524 | 88.4 |
13C chemical shifts | 451 | 380 | 84.3 |
15N chemical shifts | 108 | 98 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 192 | 177 | 92.2 |
13C chemical shifts | 190 | 174 | 91.6 |
15N chemical shifts | 94 | 86 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 401 | 347 | 86.5 |
13C chemical shifts | 261 | 206 | 78.9 |
15N chemical shifts | 14 | 12 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 61 | 84.7 |
13C chemical shifts | 72 | 61 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 24 | 61.5 |
13C chemical shifts | 37 | 12 | 32.4 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
---1160---1170------1180------1190------1200------1210------1220------1230------1240------1250- GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NLAGAVEFNDVKTLLREWITTI.DPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
---1160---1170------1180------1190------1200------1210------1220------1230------1240------1250- GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT | | ||||||||||||| || |||||||||| | || |||||||||||||| || ||||||||||||||||| ..L..A..FNDVKTLLREWIT......EE..LQVVKYCTDL.E...LE.LDLVIKYMKRLMQQ....VW.MAFDFILDNVQVVLQQT ---1160---1170------1180------1190------1200------1210------1220------1230------1240---
Dihedral angle restraints
---1160---1170------1180------1190------1200------1210------1220------1230------1240------1250- GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT || ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| |||||| .NL...VEFNDVKTLLREWITTISD.MEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNM.FDFILDNVQVVLQQTY.STLKVT