Solution NMR structure of the specialized acyl carrier protein PA3334 (apo) from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium Target PaT415.
MGSSHDHHHH SSGRENLYFQ GHMPNDMEDH LLTVLSVASG VPKEEISRDS RMEDLAFDSL VVSELSLKLR KEFGVTGVDD ELDLLETVDE LFQLVEKHRA AGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.4 % (941 of 1156) | 81.0 % (483 of 596) | 82.6 % (376 of 455) | 78.1 % (82 of 105) |
Backbone | 80.6 % (495 of 614) | 79.1 % (167 of 211) | 82.1 % (248 of 302) | 79.2 % (80 of 101) |
Sidechain | 82.9 % (529 of 638) | 82.1 % (316 of 385) | 84.7 % (211 of 249) | 50.0 % (2 of 4) |
Aromatic | 50.0 % (40 of 80) | 50.0 % (20 of 40) | 50.0 % (20 of 40) | |
Methyl | 98.2 % (108 of 110) | 96.4 % (53 of 55) | 100.0 % (55 of 55) |
1. PaT415
MGSSHDHHHH SSGRENLYFQ GHMPNDMEDH LLTVLSVASG VPKEEISRDS RMEDLAFDSL VVSELSLKLR KEFGVTGVDD ELDLLETVDE LFQLVEKHRA AGSSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz at MU
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaT415 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 450 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | zinc chloride | natural abundance | 0.01 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18468_2lte.nef |
Input source #2: Coordindates | 2lte.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA --- AGS ||| AGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 103 | 0 | 0 | 100.0 |
Content subtype: combined_18468_2lte.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA ||||||| || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............RENLYFQ..MP..MEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA --- AGS ||| AGS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
36 | SER | HG | 5.92 |
39 | SER | HG | 4.97 |
93 | GLN | CD | 180.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 596 | 480 | 80.5 |
13C chemical shifts | 455 | 369 | 81.1 |
15N chemical shifts | 110 | 76 | 69.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 162 | 76.8 |
13C chemical shifts | 206 | 161 | 78.2 |
15N chemical shifts | 101 | 74 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 385 | 318 | 82.6 |
13C chemical shifts | 249 | 208 | 83.5 |
15N chemical shifts | 9 | 2 | 22.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 57 | 96.6 |
13C chemical shifts | 59 | 57 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 20 | 50.0 |
13C chemical shifts | 40 | 20 | 50.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........................MEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA --- AGS ||| AGS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA ||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ..........................MEDHLLTVLSVASGVPKEEIS..........DSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --- AGS | A -