the pwwp domain of TFIIS2-1 from Trypanosoma brucei
MLQERVFHIN DRVWLKTGAN TWWPAKVTSV TGVEGVDGRS SETGTSTVTV LTYPGTQNKA TYKNVDSHSS AITFFEPSSE KAVTANEDLL QAIRNAEEDK ESNALRFEPT LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 68.9 % (919 of 1333) | 73.2 % (500 of 683) | 59.5 % (311 of 523) | 85.0 % (108 of 127) |
Backbone | 78.6 % (550 of 700) | 91.2 % (217 of 238) | 64.9 % (226 of 348) | 93.9 % (107 of 114) |
Sidechain | 63.6 % (474 of 745) | 63.6 % (283 of 445) | 66.2 % (190 of 287) | 7.7 % (1 of 13) |
Aromatic | 0.0 % (0 of 124) | 0.0 % (0 of 62) | 0.0 % (0 of 59) | 0.0 % (0 of 3) |
Methyl | 87.3 % (110 of 126) | 95.2 % (60 of 63) | 79.4 % (50 of 63) |
1. entity
MLQERVFHIN DRVWLKTGAN TWWPAKVTSV TGVEGVDGRS SETGTSTVTV LTYPGTQNKA TYKNVDSHSS AITFFEPSSE KAVTANEDLL QAIRNAEEDK ESNALRFEPT LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Bruker DMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tbpwwp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na2HPO4 | natural abundance | 25 mM | |
5 | NaCl | natural abundance | 150 mM | |
6 | EDTA | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18474_2m1h.nef |
Input source #2: Coordindates | 2m1h.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDK -------110-------- ESNALRFEPTLEHHHHHH |||||||||||||||||| ESNALRFEPTLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
Content subtype: combined_18474_2m1h.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------- ESNALRFEPTLEHHHHHH |||||||||||| ESNALRFEPTLE -------110--
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 683 | 495 | 72.5 |
13C chemical shifts | 523 | 295 | 56.4 |
15N chemical shifts | 132 | 107 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 238 | 216 | 90.8 |
13C chemical shifts | 236 | 109 | 46.2 |
15N chemical shifts | 114 | 107 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 445 | 279 | 62.7 |
13C chemical shifts | 287 | 186 | 64.8 |
15N chemical shifts | 18 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 60 | 93.8 |
13C chemical shifts | 64 | 48 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 0 | 0.0 |
13C chemical shifts | 59 | 0 | 0.0 |
15N chemical shifts | 3 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| .LQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFF.PSSEKAVTANEDLLQAIRNAEEDK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------- ESNALRFEPTLEHHHHHH |||||||||| ESNALRFEPT -------110
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDK ||||||||||||| |||||||||||| |||| |||||||| |||||||||| |||| |||||||||||||||||||||||| ....RVFHINDRVWLKT..NTWWPAKVTSVT........SSET.TSTVTVLT....QNKATYKNVD....AITF..PSSEKAVTANEDLLQAIRNAEEDK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------- ESNALRFEPTLEHHHHHH |||||||| .SNALRFEP ---------