Conformational analysis of StrH, the surface-attached exo- -D-N-acetylglucosaminidase from Streptococcus pneumoniae.
MGSSHHHHHS SGLVPRGSHM SLDENEVAAN VETRPELITR TEEIPFEVIK KENPNLPAGQ ENIITAGVKG ERTHYISVLT ENGKTTETVL DSQVTKEVIN QVVEVGAPVT H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.0 % (974 of 1233) | 87.7 % (558 of 636) | 64.9 % (313 of 482) | 89.6 % (103 of 115) |
Backbone | 74.2 % (485 of 654) | 89.3 % (200 of 224) | 58.5 % (190 of 325) | 90.5 % (95 of 105) |
Sidechain | 84.9 % (579 of 682) | 86.9 % (358 of 412) | 81.9 % (213 of 260) | 80.0 % (8 of 10) |
Aromatic | 16.0 % (8 of 50) | 32.0 % (8 of 25) | 0.0 % (0 of 25) | |
Methyl | 97.1 % (132 of 136) | 97.1 % (66 of 68) | 97.1 % (66 of 68) |
1. entity
MGSSHHHHHS SGLVPRGSHM SLDENEVAAN VETRPELITR TEEIPFEVIK KENPNLPAGQ ENIITAGVKG ERTHYISVLT ENGKTTETVL DSQVTKEVIN QVVEVGAPVT HSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | G5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | DSS | natural abundance | 0.5 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18484_2ltj.nef |
Input source #2: Coordindates | 2ltj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
A | 3 | . | Not matched with CCD | None |
A | 4 | . | Not matched with CCD | None |
A | 5 | . | Not matched with CCD | None |
A | 6 | . | Not matched with CCD | None |
A | 7 | . | Not matched with CCD | None |
A | 8 | . | Not matched with CCD | None |
A | 9 | . | Not matched with CCD | None |
A | 15 | . | Not matched with CCD | None |
A | 17 | . | Not matched with CCD | None |
A | 18 | . | Not matched with CCD | None |
A | 19 | . | Not matched with CCD | None |
Sequence alignments
---------10---- -- - - 20--------30--------40--------50--------60--------70--------80--------90----- ..G.......SSGLV-R.-.-S-DENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVI ||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --100------- NQVVEVGAPVTH |||||||||||| NQVVEVGAPVTH -------110--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 112 | 12 | 1 | 88.4 |
Content subtype: combined_18484_2ltj.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- G.......SSGLV.R...MSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQ | ||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| G.......SSGLV.R...MSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQ ------110- VVEVGAPVTH |||||||||| VVEVGAPVTH
Comp_index_ID | Comp_ID |
---|
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
74 | HIS | HD1 | 6.672 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 571 | 544 | 95.3 |
15N chemical shifts | 108 | 101 | 93.5 |
13C chemical shifts | 431 | 309 | 71.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 200 | 193 | 96.5 |
15N chemical shifts | 94 | 91 | 96.8 |
13C chemical shifts | 198 | 96 | 48.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 371 | 351 | 94.6 |
15N chemical shifts | 14 | 10 | 71.4 |
13C chemical shifts | 233 | 213 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 67 | 97.1 |
13C chemical shifts | 69 | 66 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 6 | 46.2 |
13C chemical shifts | 13 | 0 | 0.0 |
Distance restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- G.......SSGLV.R...MSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ................................RPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQ -------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- ------110- VVEVGAPVTH ||||||| VVEVGAP -------