The NMR structure of the Vta1-Vps60 complex
MASNAARVVA TAKDFDKVGL GIIGYYLQLY AVELILSEED RSQEMTALAT ELLDTIEAFK KEIGGESEAE DSDKSLHVMN TLIHDQEKAK IYMLNFTMSL YNEKLKQLKD GPWDVMLKRS LWCCIDLFSC ILHLWKENIS ETSTNSLQKR IKYCKIYLSK LAKGEIG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.5 % (2452 of 2651) | 93.4 % (1284 of 1375) | 90.7 % (933 of 1029) | 95.1 % (235 of 247) |
Backbone | 95.0 % (1284 of 1352) | 94.8 % (436 of 460) | 94.6 % (632 of 668) | 96.4 % (216 of 224) |
Sidechain | 89.8 % (1361 of 1515) | 92.1 % (843 of 915) | 86.7 % (500 of 577) | 78.3 % (18 of 23) |
Aromatic | 90.9 % (140 of 154) | 97.4 % (75 of 77) | 83.8 % (62 of 74) | 100.0 % (3 of 3) |
Methyl | 94.6 % (261 of 276) | 94.9 % (131 of 138) | 94.2 % (130 of 138) |
1. entity 1
MASNAARVVA TAKDFDKVGL GIIGYYLQLY AVELILSEED RSQEMTALAT ELLDTIEAFK KEIGGESEAE DSDKSLHVMN TLIHDQEKAK IYMLNFTMSL YNEKLKQLKD GPWDVMLKRS LWCCIDLFSC ILHLWKENIS ETSTNSLQKR IKYCKIYLSK LAKGEIG2. entity 2
INIDKLQDMQ DEMLDLIEQG DELQEVLAMN NNSGELDDIS DAELDAELDA LAQEDFTLPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
4 | entity_2 | natural abundance | 1.0-1.2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | natural abundance | 1.0-1.2 mM | |
8 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
4 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | natural abundance | 1.0-1.2 mM | |
8 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
4 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | natural abundance | 1.0-1.2 mM | |
8 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
4 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | natural abundance | 1.0-1.2 mM | |
8 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
2 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1.0-1.2 mM | |
6 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
4 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | natural abundance | 1.0-1.2 mM | |
8 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vta1NTD with unlabled Vps60 peptide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | entity_1 | [U-13C; U-15N] | 1.0-1.2 mM | |
4 | entity_2 | natural abundance | 1.0-1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293.15 K, pH 7.0, Details 15N,13C labled Vps60 peptide with unlabled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | natural abundance | 1.0-1.2 mM | |
8 | entity_2 | [U-13C; U-15N] | 1.0-1.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18521_2luh.nef |
Input source #2: Coordindates | 2luh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL -------110-------120-------130-------140-------150-------160------- YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
--130-----140-------150-------160-------170-------180------ INIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| INIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP --------10--------20--------30--------40--------50---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 167 | 0 | 0 | 100.0 |
B | B | 59 | 0 | 0 | 100.0 |
Content subtype: combined_18521_2luh.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL -------110-------120-------130-------140-------150-------160------- YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
--130-----140-------150-------160-------170-------180------ INIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP ||||||| ||||||||||||||||||||||||||||||||||||||||||||||| INIDKLQ.....MLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
46 | THR | HG1 | 5.996 |
50 | THR | HG1 | 5.416 |
55 | THR | HG1 | 6.425 |
77 | HIS | HE2 | 9.407 |
81 | THR | HG1 | 5.83 |
84 | HIS | HE2 | 9.618 |
142 | THR | HG1 | 5.656 |
144 | THR | HG1 | 5.827 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 780 | 729 | 93.5 |
1H chemical shifts | 1036 | 1009 | 97.4 |
15N chemical shifts | 184 | 172 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 334 | 329 | 98.5 |
1H chemical shifts | 341 | 338 | 99.1 |
15N chemical shifts | 166 | 163 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 446 | 400 | 89.7 |
1H chemical shifts | 695 | 671 | 96.5 |
15N chemical shifts | 18 | 9 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 108 | 104 | 96.3 |
1H chemical shifts | 108 | 107 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 69 | 62 | 89.9 |
1H chemical shifts | 72 | 72 | 100.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 249 | 197 | 79.1 |
1H chemical shifts | 339 | 297 | 87.6 |
15N chemical shifts | 67 | 60 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 118 | 105 | 89.0 |
1H chemical shifts | 119 | 105 | 88.2 |
15N chemical shifts | 58 | 52 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 131 | 92 | 70.2 |
1H chemical shifts | 220 | 192 | 87.3 |
15N chemical shifts | 9 | 8 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 39 | 32 | 82.1 |
1H chemical shifts | 39 | 38 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 5 | 0 | 0.0 |
1H chemical shifts | 5 | 5 | 100.0 |
Distance restraints
--130-----140-------150-------160-------170-------180------ INIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP ||||||| ||||||||||||||||||||||||||||||||||||||||||||||| INIDKLQ.....MLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL -------110-------120-------130-------140-------150-------160------- YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
--130-----140-------150-------160-------170-------180------ INIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP ||| ||| |||||||||||||||||| ||||||||||||||| .NID.LQD....MLDLIEQGDELQEVLAMN..........DAELDAELDALAQED --130-----140-------150-------160-------170-------180--
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL |||||||||||||||| | ||||||||||||||| |||||||||||||||||||| ||||||||||| ||||||||||||||| .ASNAARVVATAKDFDK..L.IIGYYLQLYAVELIL......QEMTALATELLDTIEAFKKE...........KSLHVMNTLIH.QEKAKIYMLNFTMSL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160------- YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG ||||||||| |||||||||||||||||||| ||||||||||||||||||||||| YNEKLKQLK.....VMLKRSLWCCIDLFSCILHL......ETSTNSLQKRIKYCKIYLSKLAK -------110-------120-------130-------140-------150-------160---
Dihedral angle restraints
--130-----140-------150-------160-------170-------180------ INIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP |||||||| |||||||||||||||||||||||||||||||||||||||||||||||| INIDKLQD...EMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLP
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEI..........KSLHVMNTLIHDQEKAKIYMLNFTMSL -------110-------120-------130-------140-------150-------160------- YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG