Chemical Shift Assignments for the PICK1 PDZ domain fused to the C10 DAT ligand
GSPGIPVPGK VTLQKDAQNL IGISIGGGAQ YCPCLYIVQV FDNTPAALDG TVAAGDEITG VNGRSIKGKT KVEVAKMIQE VKGEVTIHYN KLQADPKQLE VLFQGPQFTL RHWLKVGSPG IPVPGKVTLQ KDAQNLIGIS IGGGAQYCPC LYIVQVFDNT PAALDGTVAA GDEITGVNGR SIKGKTKVEV AKMIQEVKGE VTIHYNKLQA DPKQLEVLFQ GPQFTLRHWL KV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 46.1 % (1230 of 2670) | 44.5 % (617 of 1386) | 46.5 % (483 of 1038) | 52.8 % (130 of 246) |
Backbone | 54.2 % (739 of 1364) | 53.6 % (256 of 478) | 54.0 % (361 of 668) | 56.0 % (122 of 218) |
Sidechain | 39.8 % (601 of 1510) | 39.8 % (361 of 908) | 40.4 % (232 of 574) | 28.6 % (8 of 28) |
Aromatic | 13.5 % (20 of 148) | 18.9 % (14 of 74) | 6.9 % (5 of 72) | 50.0 % (1 of 2) |
Methyl | 49.3 % (148 of 300) | 51.3 % (77 of 150) | 47.3 % (71 of 150) |
1. entity
GSPGIPVPGK VTLQKDAQNL IGISIGGGAQ YCPCLYIVQV FDNTPAALDG TVAAGDEITG VNGRSIKGKT KVEVAKMIQE VKGEVTIHYN KLQADPKQLE VLFQGPQFTL RHWLKVGSPG IPVPGKVTLQ KDAQNLIGIS IGGGAQYCPC LYIVQVFDNT PAALDGTVAA GDEITGVNGR SIKGKTKVEV AKMIQEVKGE VTIHYNKLQA DPKQLEVLFQ GPQFTLRHWL KVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | TRIS | [U-99% 2H] | 50 mM | |
10 | sodium chloride | natural abundance | 125 mM | |
11 | DTT | natural abundance | 2 mM | |
12 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
13 | DSS | natural abundance | 0.25 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | TRIS | [U-99% 2H] | 50 mM | |
10 | sodium chloride | natural abundance | 125 mM | |
11 | DTT | natural abundance | 2 mM | |
12 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
13 | DSS | natural abundance | 0.25 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TRIS | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 125 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
5 | DSS | natural abundance | 0.25 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | TRIS | [U-99% 2H] | 50 mM | |
10 | sodium chloride | natural abundance | 125 mM | |
11 | DTT | natural abundance | 2 mM | |
12 | protein | [U-100% 13C; U-100% 15N] | 600 uM | |
13 | DSS | natural abundance | 0.25 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18522_2lui.nef |
Input source #2: Coordindates | 2lui.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-- GSPGIPVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSPGIPVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----120-------- VLFQGPQFTLRHWLKV |||||||||||||||| VLFQGPQFTLRHWLKV -------110------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 116 | 0 | 0 | 100.0 |
Content subtype: combined_18522_2lui.nef
Assigned chemical shifts
------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-- GSPGIPVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PGIPVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE -----120-------- VLFQGPQFTLRHWLKV ||||||| |||||| VLFQGPQ...RHWLKV
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
36 | SER | HG | 5.907 |
56 | THR | HG1 | 5.031 |
83 | LYS | HZ1 | 7.633 |
83 | LYS | HZ2 | 7.633 |
83 | LYS | HZ3 | 7.633 |
98 | THR | HG1 | 5.193 |
127 | LYS | HZ1 | 7.439 |
127 | LYS | HZ2 | 7.439 |
127 | LYS | HZ3 | 7.439 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 519 | 382 | 73.6 |
1H chemical shifts | 693 | 499 | 72.0 |
15N chemical shifts | 125 | 106 | 84.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 232 | 208 | 89.7 |
1H chemical shifts | 239 | 208 | 87.0 |
15N chemical shifts | 109 | 98 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 287 | 174 | 60.6 |
1H chemical shifts | 454 | 291 | 64.1 |
15N chemical shifts | 16 | 8 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 76 | 53 | 69.7 |
1H chemical shifts | 76 | 65 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 36 | 0 | 0.0 |
1H chemical shifts | 37 | 9 | 24.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-- GSPGIPVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE ||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GIPVPGKVTLQKDAQNLIGISIG.GA.YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE -----120-------- VLFQGPQFTLRHWLKV |||||| | ||| VLFQGP.....H.LKV
Dihedral angle restraints
------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-- GSPGIPVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLE ||||||||||| || |||||| ||| || |||||||||||||||||||||| |||||| || .........KVTLQKDAQNL.GI............YIVQVF..TPA.........DE..GVNGRSIKGKTKVEVAKMIQEV.GEVTIH.NK......... ------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-- -----120-------- VLFQGPQFTLRHWLKV |||| ...........HWLK -----120-------