Solution NMR Structure of PH Domain of Tyrosine-protein kinase Tec from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR3504C
MGHHHHHHSH MNFNTILEEI LIKRSQQKKK TSPLNYKERL FVLTKSMLTY YEGRAEKKYR KGFIDVSKIK CVEIVKNDDG VIPCQNKYPF QVVHDANTLY IFAPSPQSRD LWVKKLKEEI KNNNNIMIKY HPKFWTDGSY QCCRQTEKLA PGCEKYNLFE SSIRX
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.9 % (1832 of 2061) | 89.2 % (972 of 1090) | 88.8 % (705 of 794) | 87.6 % (155 of 177) |
Backbone | 88.1 % (855 of 970) | 88.4 % (289 of 327) | 88.7 % (431 of 486) | 86.0 % (135 of 157) |
Sidechain | 89.8 % (1122 of 1249) | 89.5 % (683 of 763) | 89.9 % (419 of 466) | 100.0 % (20 of 20) |
Aromatic | 81.2 % (164 of 202) | 82.2 % (83 of 101) | 79.8 % (79 of 99) | 100.0 % (2 of 2) |
Methyl | 98.6 % (144 of 146) | 98.6 % (72 of 73) | 98.6 % (72 of 73) |
1. HR3504C
MGHHHHHHSH MNFNTILEEI LIKRSQQKKK TSPLNYKERL FVLTKSMLTY YEGRAEKKYR KGFIDVSKIK CVEIVKNDDG VIPCQNKYPF QVVHDANTLY IFAPSPQSRD LWVKKLKEEI KNNNNIMIKY HPKFWTDGSY QCCRQTEKLA PGCEKYNLFE SSIRXSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.828 mM hr3504c.025, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hr3504c.025 | [U-5% 13C; U-100% 15N] | 0.828 mM | |
12 | DSS | natural abundance | 50 uM | |
13 | DTT | natural abundance | 10 mM | |
14 | ZnSO4 | natural abundance | 50 uM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | NaCL | natural abundance | 100 mM | |
17 | MES pH 6.5 | natural abundance | 20 mM | |
18 | Proteinase Inhibitors | natural abundance | 1 na | |
19 | D2O | natural abundance | 10 % | |
20 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.52 mM hr3504c.027, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | hr3504c.027 | [U-5% 13C; U-100% 15N] | 0.52 mM | |
22 | DSS | natural abundance | 50 uM | |
23 | DTT | natural abundance | 10 mM | |
24 | ZnSO4 | natural abundance | 50 uM | |
25 | NaN3 | natural abundance | 0.02 % | |
26 | NaCL | natural abundance | 100 mM | |
27 | MES pH 6.5 | natural abundance | 20 mM | |
28 | Proteinase Inhibitors | natural abundance | 1 na | |
29 | D2O | natural abundance | 10 % | |
30 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 1H-15N HSQC
List #1 RDC_list_1, RDC code DNH, Field strength (1H) 599.520 MHz, Details alignment media: peg
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.614 mM hr3504c.023, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hr3504c.023 | [U-100% 13C; U-100% 15N] | 0.614 mM | |
2 | DSS | natural abundance | 50 uM | |
3 | DTT | natural abundance | 10 mM | |
4 | ZnSO4 | natural abundance | 50 uM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | NaCL | natural abundance | 100 mM | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | Proteinase Inhibitors | natural abundance | 1 na | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz at Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.828 mM hr3504c.025, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hr3504c.025 | [U-5% 13C; U-100% 15N] | 0.828 mM | |
12 | DSS | natural abundance | 50 uM | |
13 | DTT | natural abundance | 10 mM | |
14 | ZnSO4 | natural abundance | 50 uM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | NaCL | natural abundance | 100 mM | |
17 | MES pH 6.5 | natural abundance | 20 mM | |
18 | Proteinase Inhibitors | natural abundance | 1 na | |
19 | D2O | natural abundance | 10 % | |
20 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz at UGA
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.52 mM hr3504c.027, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | hr3504c.027 | [U-5% 13C; U-100% 15N] | 0.52 mM | |
22 | DSS | natural abundance | 50 uM | |
23 | DTT | natural abundance | 10 mM | |
24 | ZnSO4 | natural abundance | 50 uM | |
25 | NaN3 | natural abundance | 0.02 % | |
26 | NaCL | natural abundance | 100 mM | |
27 | MES pH 6.5 | natural abundance | 20 mM | |
28 | Proteinase Inhibitors | natural abundance | 1 na | |
29 | D2O | natural abundance | 10 % | |
30 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18526_2lul.nef |
Input source #2: Coordindates | 2lul.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:131:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:142:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:143:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:153:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | Distance restraints |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY -------110-------120-------130-------140-------150-------160---- IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 164 | 0 | 0 | 100.0 |
Content subtype: combined_18526_2lul.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY ||||||||||||||||||| ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| ........SHMNFNTILEEILIKRSQQ..KTSPLNYKERLFVLTKSMLTYYEGR..KKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY -------110-------120-------130-------140-------150-------160---- IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
156 | TYR | HH | 8.834 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1090 | 980 | 89.9 |
13C chemical shifts | 794 | 700 | 88.2 |
15N chemical shifts | 184 | 152 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 327 | 289 | 88.4 |
13C chemical shifts | 328 | 280 | 85.4 |
15N chemical shifts | 157 | 132 | 84.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 763 | 691 | 90.6 |
13C chemical shifts | 466 | 420 | 90.1 |
15N chemical shifts | 27 | 20 | 74.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 75 | 97.4 |
13C chemical shifts | 77 | 75 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 83 | 82.2 |
13C chemical shifts | 99 | 79 | 79.8 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY |||||||||||||||| | ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| .........HMNFNTILEEILIKRS.Q..KTSPLNYKERLFVLTKSMLTYYEGR..KKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY -------110-------120-------130-------140-------150-------160---- IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR ||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||| IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTD.SYQCCRQTEKLAPGCEKYNLFESSIR
- X | X
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLY |||||||||||| |||||||||||||||||||| ||||||||||||||||||||| |||||||||||| ..............TILEEILIKRSQ.......LNYKERLFVLTKSMLTYYEG....KYRKGFIDVSKIKCVEIVKND..........PFQVVHDANTLY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- IFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR |||| |||||||||||||||||| ||||| |||||| IFAP.PQSRDLWVKKLKEEIKNN....IKYHP....................CEKYNL -------110-------120-------130-------140-------150--------