NMR solution structure of apo-MptpA
GMSDPLHVTF VCTGNICRSP MAEKMFAQQL RHRGLGDAVR VTSAGTGNWH VGSCADERAA GVLRAHGYPT DHRAAQVGTE HLAADLLVAL DRNHARLLRQ LGVEAARVRM LRSFDPRSGT HALDVEDPYY GDHSDFEEVF AVIESALPGL HDWVDERLAR NGPS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.2 % (1578 of 1789) | 94.7 % (870 of 919) | 78.0 % (548 of 703) | 95.8 % (160 of 167) |
Backbone | 84.3 % (818 of 970) | 97.0 % (326 of 336) | 71.3 % (340 of 477) | 96.8 % (152 of 157) |
Sidechain | 93.4 % (904 of 968) | 93.3 % (544 of 583) | 93.9 % (352 of 375) | 80.0 % (8 of 10) |
Aromatic | 78.3 % (108 of 138) | 78.3 % (54 of 69) | 79.1 % (53 of 67) | 50.0 % (1 of 2) |
Methyl | 100.0 % (182 of 182) | 100.0 % (91 of 91) | 100.0 % (91 of 91) |
1. mptpa
GMSDPLHVTF VCTGNICRSP MAEKMFAQQL RHRGLGDAVR VTSAGTGNWH VGSCADERAA GVLRAHGYPT DHRAAQVGTE HLAADLLVAL DRNHARLLRQ LGVEAARVRM LRSFDPRSGT HALDVEDPYY GDHSDFEEVF AVIESALPGL HDWVDERLAR NGPSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 950 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 950 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mptpa | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | arginine / glutamine | natural abundance | 50 mM | |
3 | HEPES | natural abundance | 25 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz CryoProbe 1H,13C,15N
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz CryoProbe 1H,13C,15N
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | mptpa | [U-100% 15N] | 1.0 mM | |
8 | arginine / glutamine | natural abundance | 50 mM | |
9 | HEPES | natural abundance | 25 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18533_2luo.nef |
Input source #2: Coordindates | 2luo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS -------110-------120-------130-------140-------150-------160----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 164 | 0 | 0 | 100.0 |
Content subtype: combined_18533_2luo.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ ||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMSDPLHVTFVCTGNIC.SPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
71 | HIS | HE2 | 10.57 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 919 | 866 | 94.2 |
13C chemical shifts | 703 | 516 | 73.4 |
15N chemical shifts | 183 | 159 | 86.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 328 | 97.6 |
13C chemical shifts | 328 | 163 | 49.7 |
15N chemical shifts | 157 | 151 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 583 | 538 | 92.3 |
13C chemical shifts | 375 | 353 | 94.1 |
15N chemical shifts | 26 | 8 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 94 | 98.9 |
13C chemical shifts | 95 | 94 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 54 | 78.3 |
13C chemical shifts | 67 | 53 | 79.1 |
15N chemical shifts | 2 | 1 | 50.0 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ ||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMSDPLHVTFVCTGNIC.SPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ ||||||| ||||||||||||||||| | | | || ||||||||||| | ||| || ||||||||||||||| .....LHVTFVC....CRSPMAEKMFAQQLRHR....A.R.T.AG..........DERAAGVLRAH........A.VGT..LA..LLVALDRNHARLLRQ 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS | | | | ||||||||||||||| ||||||||||||| L.....R.R.L.....................HSDFEEVFAVIESAL.GLHDWVDERLARN 0-------110-------120-------130-------140-------150-------160
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNG 0-------110-------120-------130-------140-------150-------160-
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
RDC restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ ||| ||| | ||||| ||| ||||||||||||||||| |||||| |||| | || ||| | |||||||||||| |||||||| ||||| .MSD.LHV..V.........MAEKM.AQQ.RHRGLGDAVRVTSAGTG.WHVGSC.DERA.G.LR.HGY.T..RAAQVGTEHLAA.LLVALDRN.ARLLR. 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS ||| |||||||||| ||| || || |||| ||| || | |||| |||| ||| |||| LGV.AARVRMLRSF..RSG..AL..ED.YYGD.SDF..VF.V.ESAL.GLHD..DER.ARNG 0-------110-------120-------130-------140-------150-------160-
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQ ||||| | ||||| ||| |||||| ||||||||||||| ||| |||| |||| ||| | |||||||||||| ||||| |||||| ......HVTFV...N.....MAEKM.AQQ.RHRGLG.AVRVTSAGTGNWH.GSC.DERA.GVLR.HGY.T..RAAQVGTEHLAA.LLVAL....ARLLRQ 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130-------140-------150-------160--- LGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS ||||| |||||||| || ||| ||| ||||| |||| |||| ||| LGVEA.RVRMLRSF...........ED..YGD.SDF.EVFAV.ESAL.GLHD..DER 0-------110-------120-------130-------140-------150------