SOLUTION STRUCTURE OF DOUBLE-STRANDED RNA BINDING DOMAIN OF S.CEREVISIAE RNASE III (RNT1P)
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.5 % (895 of 1023) | 85.0 % (453 of 533) | 89.9 % (357 of 397) | 91.4 % (85 of 93) |
Backbone | 96.4 % (515 of 534) | 95.1 % (176 of 185) | 97.3 % (255 of 262) | 96.6 % (84 of 87) |
Sidechain | 80.2 % (458 of 571) | 79.0 % (275 of 348) | 83.9 % (182 of 217) | 16.7 % (1 of 6) |
Aromatic | 34.8 % (16 of 46) | 69.6 % (16 of 23) | 0.0 % (0 of 23) | |
Methyl | 95.5 % (107 of 112) | 94.6 % (53 of 56) | 96.4 % (54 of 56) |
1. Ribonuclease III
GSLDMNAKRQ LYSLIGYASL RLHYVTVKKP TAVDPNSIVE CRVGDGTVLG TGVGRNIKIA GIRAAENALR DKKMLDFYAK QRAAIPRSESSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | D2O | [U-100% 2H] | 100 % | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | D2O | [U-100% 2H] | 100 % | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | D2O | [U-100% 2H] | 100 % | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM phosphate, Ph6.5, 150mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ribonuclease III | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | D2O | [U-100% 2H] | 100 % | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18535_2luq.nef |
Input source #2: Coordindates | 2luq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----370-------380-------390-------400-------410-------420-------430-------440-------450--- GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES --------10--------20--------30--------40--------50--------60--------70--------80--------90
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 90 | 0 | 0 | 100.0 |
Content subtype: combined_18535_2luq.nef
Assigned chemical shifts
----370-------380-------390-------400-------410-------420-------430-------440-------450--- GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
386 | HIS | HD1 | 6.74 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 397 | 355 | 89.4 |
1H chemical shifts | 533 | 432 | 81.1 |
15N chemical shifts | 101 | 84 | 83.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 180 | 173 | 96.1 |
1H chemical shifts | 185 | 174 | 94.1 |
15N chemical shifts | 87 | 84 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 217 | 182 | 83.9 |
1H chemical shifts | 348 | 258 | 74.1 |
15N chemical shifts | 14 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 58 | 55 | 94.8 |
1H chemical shifts | 58 | 53 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 23 | 0 | 0.0 |
1H chemical shifts | 23 | 16 | 69.6 |
Distance restraints
----370-------380-------390-------400-------410-------420-------430-------440-------450--- GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES ||||||||||||||| |||||||||| |||| |||||||||||||||||||||||||||||||||||||||||||||||||| |||| ..LDMNAKRQLYSLIGY..LRLHYVTVKK.TAVD.NSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAI.RSES
Dihedral angle restraints
----370-------380-------390-------400-------410-------420-------430-------440-------450--- GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...DMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAI ----370-------380-------390-------400-------410-------420-------430-------440--------
RDC restraints
----370-------380-------390-------400-------410-------420-------430-------440-------450--- GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES |||||||||| ||||| ||||||| ||||||| |||||||||||| |||||||||||||| ......AKRQLYSLIG......HYVTV.........SIVECRV....VLGTGVG...KIAGIRAAENAL..KKMLDFYAKQRAAI ----370-------380-------390-------400-------410-------420-------430-------440--------