NMR structure of Carcinoscorpius rotundicauda thioredoxin related protein 16 and its role in regulating transcription factor NF-kB activity
MEFIQGIKLV KKNRCEVNAN EALKDKDIIG FYFSAHWCPP CRGFTPILAD MYSELVDDSA PFEIIFVSSD RSEDDMFQYM MESHGDWLAI PYRSGPASNV TAKYGITGIP ALVIVKKDGT LISMNGRGEV QSLGPRAFQN WAR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.7 % (1333 of 1672) | 84.5 % (734 of 869) | 70.8 % (464 of 655) | 91.2 % (135 of 148) |
Backbone | 81.1 % (683 of 842) | 93.4 % (270 of 289) | 68.7 % (287 of 418) | 93.3 % (126 of 135) |
Sidechain | 80.7 % (776 of 962) | 80.2 % (465 of 580) | 81.8 % (302 of 369) | 69.2 % (9 of 13) |
Aromatic | 47.0 % (77 of 164) | 53.7 % (44 of 82) | 39.2 % (31 of 79) | 66.7 % (2 of 3) |
Methyl | 100.0 % (142 of 142) | 100.0 % (71 of 71) | 100.0 % (71 of 71) |
1. protein 16
MEFIQGIKLV KKNRCEVNAN EALKDKDIIG FYFSAHWCPP CRGFTPILAD MYSELVDDSA PFEIIFVSSD RSEDDMFQYM MESHGDWLAI PYRSGPASNV TAKYGITGIP ALVIVKKDGT LISMNGRGEV QSLGPRAFQN WARSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | glycerol | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | [U-2H] | 5 % | |
7 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | glycerol | natural abundance | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | [U-2H] | 5 % | |
14 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | sodium chloride | natural abundance | 100 mM | |
16 | DTT | natural abundance | 5 mM | |
17 | EDTA | natural abundance | 1 mM | |
18 | Pf1 phage | natural abundance | 8 mg/mL | |
19 | H2O | natural abundance | 95 % | |
20 | D2O | [U-2H] | 5 % | |
21 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | indirect | 0.25 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | na | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | indirect | 0.25 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | na | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | indirect | 0.25 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | na | indirect | 0.1 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | glycerol | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | [U-2H] | 5 % | |
7 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | glycerol | natural abundance | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | [U-2H] | 5 % | |
14 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | glycerol | natural abundance | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | [U-2H] | 5 % | |
14 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | glycerol | natural abundance | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | [U-2H] | 5 % | |
14 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 5 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | glycerol | natural abundance | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | [U-2H] | 5 % | |
14 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | sodium chloride | natural abundance | 100 mM | |
16 | DTT | natural abundance | 5 mM | |
17 | EDTA | natural abundance | 1 mM | |
18 | Pf1 phage | natural abundance | 8 mg/mL | |
19 | H2O | natural abundance | 95 % | |
20 | D2O | [U-2H] | 5 % | |
21 | protein_16 | [U-100% 13C; U-100% 15N] | 1.0 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18539_2lus.nef |
Input source #2: Coordindates | 2lus.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEFIQGIKLVKKNRCEVNANEALKDKDIIGFYFSAHWCPPCRGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEFIQGIKLVKKNRCEVNANEALKDKDIIGFYFSAHWCPPCRGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNV -------110-------120-------130-------140--- TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR ||||||||||||||||||||||||||||||||||||||||||| TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 143 | 0 | 0 | 100.0 |
Content subtype: combined_18539_2lus.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEFIQGIKLVKKNRCEVNANEALKDKDIIGFYFSAHWCPPCRGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNV | ||||||||||||||||||||||| |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| M.FIQGIKLVKKNRCEVNANEALKD.DIIGFYFSAHWC...RGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNV -------110-------120-------130-------140--- TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR ||||||||||||||||||||||||||||||||||||||||||| TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 869 | 730 | 84.0 |
13C chemical shifts | 655 | 433 | 66.1 |
15N chemical shifts | 155 | 133 | 85.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 272 | 94.1 |
13C chemical shifts | 286 | 135 | 47.2 |
15N chemical shifts | 135 | 124 | 91.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 580 | 458 | 79.0 |
13C chemical shifts | 369 | 298 | 80.8 |
15N chemical shifts | 20 | 9 | 45.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 77 | 100.0 |
13C chemical shifts | 77 | 77 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 44 | 53.7 |
13C chemical shifts | 79 | 31 | 39.2 |
15N chemical shifts | 3 | 2 | 66.7 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEFIQGIKLVKKNRCEVNANEALKDKDIIGFYFSAHWCPPCRGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNV ||||||||||||||||||||||| |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| ..FIQGIKLVKKNRCEVNANEALKD.DIIGFYFSAHWC...RGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRS.PASNV -------110-------120-------130-------140--- TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR ||||||||||||||||||||||||||||||||||||||||||| TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEFIQGIKLVKKNRCEVNANEALKDKDIIGFYFSAHWCPPCRGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNV |||||||||||||||||||||| |||||||| ||||||||||||||||||| ||||||||||||||||||||||| ||||| |||||| ..FIQGIKLVKKNRCEVNANEALK..DIIGFYFS......CRGFTPILADMYSELVDDS.PFEIIFVSSDRSEDDMFQYMMES...WLAIP...GPASNV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--- TAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR ||||| |||||||||||||||| ||||||||||||||| TAKYG...IPALVIVKKDGTLISM...GEVQSLGPRAFQNWA -------110-------120-------130-------140--
RDC restraints