NMR solution structure of midkine-a
GSKNKKEKNK GGKGGADCAE WLYGSCVANN GDCGQGMREG TCNEQTRKVK CRVPCNWKKE FGADCKYKFG NWGECDAATS TKSRTGTLQK ALFNVECQQT VSVTKPCTTK VKNKPKGKKG KGKGN
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS18:SG | 1:CYS42:SG |
2 | disulfide | sing | 1:CYS26:SG | 1:CYS51:SG |
3 | disulfide | sing | 1:CYS33:SG | 1:CYS55:SG |
4 | disulfide | sing | 1:CYS65:SG | 1:CYS97:SG |
5 | disulfide | sing | 1:CYS75:SG | 1:CYS107:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 75.8 % (1077 of 1421) | 75.5 % (571 of 756) | 72.6 % (381 of 525) | 89.3 % (125 of 140) |
Backbone | 79.0 % (588 of 744) | 90.6 % (240 of 265) | 66.1 % (236 of 357) | 91.8 % (112 of 122) |
Sidechain | 75.3 % (590 of 784) | 67.4 % (331 of 491) | 89.5 % (246 of 275) | 72.2 % (13 of 18) |
Aromatic | 87.8 % (72 of 82) | 87.8 % (36 of 41) | 86.8 % (33 of 38) | 100.0 % (3 of 3) |
Methyl | 100.0 % (74 of 74) | 100.0 % (37 of 37) | 100.0 % (37 of 37) |
1. midkine-a
GSKNKKEKNK GGKGGADCAE WLYGSCVANN GDCGQGMREG TCNEQTRKVK CRVPCNWKKE FGADCKYKFG NWGECDAATS TKSRTGTLQK ALFNVECQQT VSVTKPCTTK VKNKPKGKKG KGKGNSolvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95%H2O, 5 % D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 10 mM NaH2PO4/ Na2HPO4 at pH 6.5, 0.1 mM NaN3, 100 mM NaCl, 1 mM EDTA, 95%H2O, 5 % D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | sodium azide | natural abundance | 0.1 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | midkine-a | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18540_2lut.nef |
Input source #2: Coordindates | 2lut.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:18:CYS:SG | A:42:CYS:SG | oxidized, CA 56.914, CB 42.32 ppm | oxidized, CA 54.955, CB 39.219 ppm | 2.119 |
A:26:CYS:SG | A:51:CYS:SG | oxidized, CA 55.777, CB 41.304 ppm | oxidized, CA 54.486, CB 45.921 ppm | 1.986 |
A:33:CYS:SG | A:55:CYS:SG | oxidized, CA 55.885, CB 47.24 ppm | unknown, CA 53.258 ppm | 2.126 |
A:65:CYS:SG | A:97:CYS:SG | oxidized, CA 53.149, CB 42.646 ppm | oxidized, CA 53.772, CB 44.152 ppm | 2.001 |
A:75:CYS:SG | A:107:CYS:SG | oxidized, CA 56.051, CB 40.212 ppm | oxidized, CA 54.701, CB 44.237 ppm | 2.139 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT -------110-------120----- VSVTKPCTTKVKNKPKGKKGKGKGN ||||||||||||||||||||||||| VSVTKPCTTKVKNKPKGKKGKGKGN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_18540_2lut.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT | ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| G..NKKEKNK..KGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT -------110-------120----- VSVTKPCTTKVKNKPKGKKGKGKGN ||||||||||||||||||||||||| VSVTKPCTTKVKNKPKGKKGKGKGN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 756 | 553 | 73.1 |
13C chemical shifts | 525 | 367 | 69.9 |
15N chemical shifts | 144 | 122 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 265 | 239 | 90.2 |
13C chemical shifts | 250 | 121 | 48.4 |
15N chemical shifts | 122 | 109 | 89.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 491 | 314 | 64.0 |
13C chemical shifts | 275 | 246 | 89.5 |
15N chemical shifts | 22 | 13 | 59.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 37 | 97.4 |
13C chemical shifts | 38 | 37 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 36 | 87.8 |
13C chemical shifts | 38 | 33 | 86.8 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT | | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....K.E.......GADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120----- VSVTKPCTTKVKNKPKGKKGKGKGN ||||||||||||||||||||| VSVTKPCTTKVKNKPKGKKGK -------110-------120-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQT |||||||||| ||||||||||||||||||||||||| ||||||| |||||||||||||||||||| |||||| ...................EWLYGSCVAN..DCGQGMREGTCNEQTRKVKCRVPCN.......DCKYKFG..GECDAATSTKSRTGTLQKAL..VECQQT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120----- VSVTKPCTTKVKNKPKGKKGKGKGN ||||||||| ||| VSVTKPCTT...NKP -------110-----