ZirS C-terminal Domain
GPLGSGSKIK LEIYNETDMA SASGYTPVPS VSEFQYIETE TISNTPSPDL TVMSIDKSVL SPGESATITT IVKDIDGNPV NEVHINKTVA RENLKGLWDY GPLKKENVPG KYTQVITYRG HSNERIDISF KYAMSFTKEI SIRGRL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.0 % (1442 of 1676) | 87.1 % (758 of 870) | 84.8 % (558 of 658) | 85.1 % (126 of 148) |
Backbone | 91.4 % (784 of 858) | 88.4 % (260 of 294) | 94.6 % (404 of 427) | 87.6 % (120 of 137) |
Sidechain | 82.9 % (790 of 953) | 86.5 % (498 of 576) | 78.1 % (286 of 366) | 54.5 % (6 of 11) |
Aromatic | 83.0 % (88 of 106) | 90.6 % (48 of 53) | 76.9 % (40 of 52) | 0.0 % (0 of 1) |
Methyl | 88.4 % (145 of 164) | 98.8 % (81 of 82) | 78.0 % (64 of 82) |
1. ZirS
GPLGSGSKIK LEIYNETDMA SASGYTPVPS VSEFQYIETE TISNTPSPDL TVMSIDKSVL SPGESATITT IVKDIDGNPV NEVHINKTVA RENLKGLWDY GPLKKENVPG KYTQVITYRG HSNERIDISF KYAMSFTKEI SIRGRLSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian Unity - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZirS | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 0.1 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18553_2lv4.nef |
Input source #2: Coordindates | 2lv4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230 GPLGSGSKIKLEIYNETDMASASGYTPVPSVSEFQYIETETISNTPSPDLTVMSIDKSVLSPGESATITTIVKDIDGNPVNEVHINKTVARENLKGLWDY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSGSKIKLEIYNETDMASASGYTPVPSVSEFQYIETETISNTPSPDLTVMSIDKSVLSPGESATITTIVKDIDGNPVNEVHINKTVARENLKGLWDY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------240-------250-------260-------270------ GPLKKENVPGKYTQVITYRGHSNERIDISFKYAMSFTKEISIRGRL |||||||||||||||||||||||||||||||||||||||||||||| GPLKKENVPGKYTQVITYRGHSNERIDISFKYAMSFTKEISIRGRL -------110-------120-------130-------140------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 146 | 0 | 0 | 100.0 |
Content subtype: combined_18553_2lv4.nef
Assigned chemical shifts
-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230 GPLGSGSKIKLEIYNETDMASASGYTPVPSVSEFQYIETETISNTPSPDLTVMSIDKSVLSPGESATITTIVKDIDGNPVNEVHINKTVARENLKGLWDY ||||| ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| .PLGSG.KIKLEIYNETDMASASGYTPVPSVSEF.YIETETISNTPSPDLTVMSIDKSVLSPGESATITTIVKDIDG.PVNEVHINKTVARENLKGLWDY -------240-------250-------260-------270------ GPLKKENVPGKYTQVITYRGHSNERIDISFKYAMSFTKEISIRGRL | ||||||||||||||||| |||||||||||||||||||||||||| G.LKKENVPGKYTQVITYR.HSNERIDISFKYAMSFTKEISIRGRL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 870 | 753 | 86.6 |
13C chemical shifts | 658 | 540 | 82.1 |
15N chemical shifts | 153 | 125 | 81.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 294 | 257 | 87.4 |
13C chemical shifts | 292 | 270 | 92.5 |
15N chemical shifts | 137 | 119 | 86.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 576 | 496 | 86.1 |
13C chemical shifts | 366 | 270 | 73.8 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 82 | 96.5 |
13C chemical shifts | 85 | 57 | 67.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 48 | 90.6 |
13C chemical shifts | 52 | 39 | 75.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230 GPLGSGSKIKLEIYNETDMASASGYTPVPSVSEFQYIETETISNTPSPDLTVMSIDKSVLSPGESATITTIVKDIDGNPVNEVHINKTVARENLKGLWDY |||| |||| ||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| ..LGSG.KIKL.IYNETDMASASGYTPVPSVSE..YIETETISNTPSPDLTVMSIDKSVLSPGESATITTIVKDIDG.PVNEVHINKTVARENLKGLWDY -------240-------250-------260-------270------ GPLKKENVPGKYTQVITYRGHSNERIDISFKYAMSFTKEISIRGRL | ||||||||||||||||| |||||||||||||||||||||||||| G.LKKENVPGKYTQVITYR.HSNERIDISFKYAMSFTKEISIRGRL