Telokin-like domain (TL-domain) from P22 coat protein
GSTATGITVS GAQSFKPVAW QLDNDGNKVN VDNRFATVTL SATTGMKRGD KISFAGVKFL GQMAKNVLAQ DATFSVVRVV DGTHVEITPK PVALDDVSLS PEQRAYANVN TSLADAMAVN ILNV
Polymer type: polypeptide(D)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.6 % (1279 of 1352) | 93.9 % (645 of 687) | 97.0 % (514 of 530) | 88.9 % (120 of 135) |
Backbone | 97.4 % (717 of 736) | 96.0 % (243 of 253) | 98.9 % (359 of 363) | 95.8 % (115 of 120) |
Sidechain | 92.6 % (677 of 731) | 92.6 % (402 of 434) | 95.7 % (270 of 282) | 33.3 % (5 of 15) |
Aromatic | 85.1 % (63 of 74) | 94.6 % (35 of 37) | 75.0 % (27 of 36) | 100.0 % (1 of 1) |
Methyl | 99.4 % (167 of 168) | 100.0 % (84 of 84) | 98.8 % (83 of 84) |
1. TL-domain
GSTATGITVS GAQSFKPVAW QLDNDGNKVN VDNRFATVTL SATTGMKRGD KISFAGVKFL GQMAKNVLAQ DATFSVVRVV DGTHVEITPK PVALDDVSLS PEQRAYANVN TSLADAMAVN ILNVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.2 % w/v |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TL-domain | [U-15N] | 1.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.2 % w/v |
Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | TL-domain | natural abundance | 1.5 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | sodium azide | natural abundance | 0.2 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TL-domain | [U-15N] | 1.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | TL-domain | natural abundance | 1.5 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | TL-domain | natural abundance | 1.5 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TL-domain | [U-15N] | 1.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TL-domain | [U-15N] | 1.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TL-domain | [U-15N] | 1.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TL-domain | [U-15N] | 1.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | TL-domain | natural abundance | 1.5 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | sodium azide | natural abundance | 0.2 % w/v |
Varian Inova - 600 MHz
State isotropic, Solvent system 99.8% D2O/0.2% H2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | TL-domain | [U-13C; U-15N] | 1.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.2 % w/v |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18566_2m5s.nef |
Input source #2: Coordindates | 2m5s.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--220-------230-------240-------250-------260-------270-------280-------290-------300-------310----- HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --320-------330-------340----- DDVSLSPEQRAYANVNTSLADAMAVNILNV |||||||||||||||||||||||||||||| DDVSLSPEQRAYANVNTSLADAMAVNILNV -------110-------120-------130
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_18566_2m5s.nef
Assigned chemical shifts
--220-------230-------240-------250-------260-------270-------280-------290-------300-------310----- HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......STATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL --320-------330-------340----- DDVSLSPEQRAYANVNTSLADAMAVNILNV |||||||||||||||||||||||||||||| DDVSLSPEQRAYANVNTSLADAMAVNILNV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 723 | 638 | 88.2 |
13C chemical shifts | 560 | 511 | 91.2 |
15N chemical shifts | 145 | 119 | 82.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 265 | 241 | 90.9 |
13C chemical shifts | 260 | 243 | 93.5 |
15N chemical shifts | 126 | 114 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 458 | 397 | 86.7 |
13C chemical shifts | 300 | 268 | 89.3 |
15N chemical shifts | 19 | 5 | 26.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 87 | 83 | 95.4 |
13C chemical shifts | 87 | 82 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 35 | 71.4 |
13C chemical shifts | 48 | 27 | 56.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--220-------230-------240-------250-------260-------270-------280-------290-------300-------310----- HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL ||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......STATGITVSGAQSFKPVAW.L..DGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL --320-------330-------340----- DDVSLSPEQRAYANVNTSLADAMAVNILNV |||||||||||||||||||||||||||||| DDVSLSPEQRAYANVNTSLADAMAVNILNV
Dihedral angle restraints
--220-------230-------240-------250-------260-------270-------280-------290-------300-------310----- HHHHHHGSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVAL |||||||||||||||||||| ||| ||||||||||||||||||||||||| ||| ||||||||||||||||||||||||| ...........GITVSGAQSFKPVAWQLDND......DNR.ATVTLSATTGMKRGDKISFAGVKFL..MAK....QDATFSVVRVVDGTHVEITPKPVAL --320-------330-------340----- DDVSLSPEQRAYANVNTSLADAMAVNILNV ||||||||||| | |||||||||||||| DDVSLSPEQRA...V.TSLADAMAVNILNV