MHV nsp3a
GKKVEFNDKP KVRKIPSTRK IKITFALDAT FDSVLSKACS EFEVDKDVTL DELLDVVLDA VESTLSPCKE HDVIGTKVCA LLDRLAGDYV YLFDEGGDEV IAPRMYCSFS APDD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.0 % (1130 of 1299) | 89.8 % (601 of 669) | 81.0 % (421 of 520) | 98.2 % (108 of 110) |
Backbone | 96.9 % (653 of 674) | 97.8 % (223 of 228) | 95.8 % (323 of 337) | 98.2 % (107 of 109) |
Sidechain | 79.4 % (583 of 734) | 85.7 % (378 of 441) | 69.9 % (204 of 292) | 100.0 % (1 of 1) |
Aromatic | 53.4 % (47 of 88) | 70.5 % (31 of 44) | 36.4 % (16 of 44) | |
Methyl | 84.3 % (118 of 140) | 97.1 % (68 of 70) | 71.4 % (50 of 70) |
1. MHV nsp3a
GKKVEFNDKP KVRKIPSTRK IKITFALDAT FDSVLSKACS EFEVDKDVTL DELLDVVLDA VESTLSPCKE HDVIGTKVCA LLDRLAGDYV YLFDEGGDEV IAPRMYCSFS APDDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.00
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MHV nsp3a | [U-100% 13C; U-100% 15N] | 200 uM | |
8 | potassium chloride | natural abundance | 100 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | TCEP | natural abundance | 5 mM | |
11 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18587_2m0a.nef |
Input source #2: Coordindates | 2m0a.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEV -------110---- IAPRMYCSFSAPDD |||||||||||||| IAPRMYCSFSAPDD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_18587_2m0a.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEV -------110---- IAPRMYCSFSAPDD |||||||||||||| IAPRMYCSFSAPDD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
39 | CYS | HG | 2.929 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 669 | 598 | 89.4 |
13C chemical shifts | 520 | 407 | 78.3 |
15N chemical shifts | 114 | 107 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 228 | 224 | 98.2 |
13C chemical shifts | 228 | 215 | 94.3 |
15N chemical shifts | 109 | 106 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 441 | 374 | 84.8 |
13C chemical shifts | 292 | 192 | 65.8 |
15N chemical shifts | 5 | 1 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 65 | 91.5 |
13C chemical shifts | 71 | 43 | 60.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 30 | 68.2 |
13C chemical shifts | 44 | 16 | 36.4 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| |||||||| |||||||||||||||||| GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLS.CKEHD.IGTKVCAL.DRLAGDYVYLFDEGGDEV -------110---- IAPRMYCSFSAPDD |||||||||||||| IAPRMYCSFSAPDD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEV ||| |||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| .......DKP.VRKIPSTRKIKITFAL.ATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAG.YVYLFDEGGDEV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- IAPRMYCSFSAPDD |||||||||||| IAPRMYCSFSAP -------110--
RDC restraints