Solution NMR Structure of Human Transcription Elongation Factor A protein 2, Central Domain, Northeast Structural Genomics Consortium (NESG) Target HR8682B
SHMPVPVTCD AVRNKCREML TAALQTDHDH VAIGADCERL SAQIEECIFR DVGNTDMKYK NRVRSRISNL KDAKNPDLRR NVLCGAITPQ QIAVMTSEEM ASDELKEIRK AMT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.0 % (1162 of 1277) | 90.4 % (605 of 669) | 91.8 % (449 of 489) | 90.8 % (108 of 119) |
Backbone | 93.1 % (624 of 670) | 93.3 % (210 of 225) | 93.8 % (315 of 336) | 90.8 % (99 of 109) |
Sidechain | 89.7 % (643 of 717) | 89.0 % (395 of 444) | 90.9 % (239 of 263) | 90.0 % (9 of 10) |
Aromatic | 60.0 % (18 of 30) | 60.0 % (9 of 15) | 60.0 % (9 of 15) | |
Methyl | 99.2 % (123 of 124) | 100.0 % (62 of 62) | 98.4 % (61 of 62) |
1. HR8682B
SHMPVPVTCD AVRNKCREML TAALQTDHDH VAIGADCERL SAQIEECIFR DVGNTDMKYK NRVRSRISNL KDAKNPDLRR NVLCGAITPQ QIAVMTSEEM ASDELKEIRK AMTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HR8682B.004 | [5% 13C; U-100% 15N] | 1.0 mM | |
7 | NaCl | natural abundance | 100 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | NaN3 | natural abundance | 0.02 % | |
10 | TRIS | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8682B.004 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR8682B.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HR8682B.004 | [5% 13C; U-100% 15N] | 1.0 mM | |
7 | NaCl | natural abundance | 100 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | NaN3 | natural abundance | 0.02 % | |
10 | TRIS | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18605_2lw4.nef |
Input source #2: Coordindates | 2lw4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM -------110--- ASDELKEIRKAMT ||||||||||||| ASDELKEIRKAMT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_18605_2lw4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM ||||||| ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ..MPVPVTC.AVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNT..KYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM -------110--- ASDELKEIRKAMT ||||||||||||| ASDELKEIRKAMT
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
21 | THR | HG1 | 4.863 |
37 | CYS | HG | 1.028 |
41 | SER | HG | 4.441 |
88 | THR | HG1 | 5.535 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 669 | 602 | 90.0 |
13C chemical shifts | 489 | 447 | 91.4 |
15N chemical shifts | 129 | 107 | 82.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 225 | 209 | 92.9 |
13C chemical shifts | 226 | 209 | 92.5 |
15N chemical shifts | 109 | 98 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 444 | 393 | 88.5 |
13C chemical shifts | 263 | 238 | 90.5 |
15N chemical shifts | 20 | 9 | 45.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 67 | 98.5 |
13C chemical shifts | 68 | 66 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 9 | 60.0 |
13C chemical shifts | 15 | 9 | 60.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM ||||||| ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ..MPVPVTC.AVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNT..KYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM -------110--- ASDELKEIRKAMT ||||||||||||| ASDELKEIRKAMT
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM ||||| |||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| ...PVPVT..AVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGN..MKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--- ASDELKEIRKAMT |||||| ASDELK ------