1H, 13C and 15N resonance assignment of the soluble form of the Lipid-modified Azurin from Neisseria gonorrhoeae
ATAGNCAATV ESNDNMQFNT KDIQVSKACK EFTITLKHTG TQPKASMGHN LVIAKAEDMD GVFKDGVGAA DTDYVKPDDA RVVAHTKLIG GGEESSLTLD PAKLADGDYK FACTFPGHGA LMNGKVTLVD
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS6:SG | 1:CYS29:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.3 % (1372 of 1396) | 98.7 % (704 of 713) | 97.6 % (535 of 548) | 98.5 % (133 of 135) |
Backbone | 99.4 % (767 of 772) | 98.9 % (266 of 269) | 100.0 % (377 of 377) | 98.4 % (124 of 126) |
Sidechain | 97.4 % (722 of 741) | 98.6 % (438 of 444) | 95.5 % (275 of 288) | 100.0 % (9 of 9) |
Aromatic | 78.0 % (64 of 82) | 87.8 % (36 of 41) | 68.3 % (28 of 41) | |
Methyl | 100.0 % (144 of 144) | 100.0 % (72 of 72) | 100.0 % (72 of 72) |
1. Laz
ATAGNCAATV ESNDNMQFNT KDIQVSKACK EFTITLKHTG TQPKASMGHN LVIAKAEDMD GVFKDGVGAA DTDYVKPDDA RVVAHTKLIG GGEESSLTLD PAKLADGDYK FACTFPGHGA LMNGKVTLVDSolvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Laz | [U-98% 15N] | 1.0 mM | |
8 | Phosphate | natural abundance | 20 mM | |
9 | Azide | natural abundance | 1 mM | |
10 | Ascorbate | natural abundance | 5 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | HDO | protons | 4.7 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | HDO | protons | 4.7 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | HDO | protons | 4.7 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | HDO | protons | 4.7 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Laz | [U-98% 15N] | 1.0 mM | |
8 | Phosphate | natural abundance | 20 mM | |
9 | Azide | natural abundance | 1 mM | |
10 | Ascorbate | natural abundance | 5 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Laz | [U-98% 13C; U-98% 15N] | 1.5 mM | |
2 | Phosphate | natural abundance | 20.0 mM | |
3 | Azide | natural abundance | 1.0 mM | |
4 | Ascorbate | natural abundance | 5.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18636_2n0m.nef |
Input source #2: Coordindates | 2n0m.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:118:HIS:ND1 | 2:1:CU1:CU | unknown | unknown | n/a |
1:49:HIS:ND1 | 2:1:CU1:CU | unknown | unknown | n/a |
1:113:CYS:SG | 2:1:CU1:CU | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CU1 | COPPER (I) ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD -------110-------120-------130 PAKLADGDYKFACTFPGHGALMNGKVTLVD |||||||||||||||||||||||||||||| PAKLADGDYKFACTFPGHGALMNGKVTLVD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_18636_2n0m.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD -------110-------120-------130 PAKLADGDYKFACTFPGHGALMNGKVTLVD |||||||||||||||||||||||||||||| PAKLADGDYKFACTFPGHGALMNGKVTLVD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | ASN | CG | 176.979 |
13 | ASN | CG | 177.087 |
15 | ASN | CG | 177.397 |
17 | GLN | CD | 181.35 |
19 | ASN | CG | 178.807 |
24 | GLN | CD | 180.318 |
38 | HIS | HE2 | 10.897 |
38 | HIS | ND1 | 248.669 |
38 | HIS | NE2 | 163.275 |
42 | GLN | CD | 180.098 |
49 | HIS | HE2 | 10.663 |
49 | HIS | ND1 | 234.086 |
49 | HIS | NE2 | 158.704 |
50 | ASN | CG | 173.82 |
85 | HIS | NE2 | 179.025 |
118 | HIS | HE2 | 11.379 |
118 | HIS | ND1 | 233.581 |
118 | HIS | NE2 | 161.949 |
123 | ASN | CG | 176.982 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 713 | 704 | 98.7 |
13C chemical shifts | 548 | 535 | 97.6 |
15N chemical shifts | 136 | 132 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 269 | 266 | 98.9 |
13C chemical shifts | 260 | 260 | 100.0 |
15N chemical shifts | 126 | 123 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 444 | 438 | 98.6 |
13C chemical shifts | 288 | 275 | 95.5 |
15N chemical shifts | 10 | 9 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 76 | 100.0 |
13C chemical shifts | 76 | 76 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 36 | 87.8 |
13C chemical shifts | 41 | 28 | 68.3 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD -------110-------120-------130 PAKLADGDYKFACTFPGHGALMNGKVTLVD |||||||||||||||||||||||||||||| PAKLADGDYKFACTFPGHGALMNGKVTLVD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLD |||||||| ||||| |||||||||| ||||||||||||||||||||| ||||||||| |||||||| .....CAATVESN.......KDIQV....KEFTITLKHT........GHNLVIAKAEDMDGVFKDGVG.............VVAHTKLIG..EESSLTLD -------110-------120-------130 PAKLADGDYKFACTFPGHGALMNGKVTLVD |||| ||||||| |||| ||||||| PAKL...DYKFACT...HGAL..GKVTLVD