NMR Structures of Single-chain Insulin
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.4 % (554 of 641) | 93.6 % (309 of 330) | 76.4 % (191 of 250) | 88.5 % (54 of 61) |
Backbone | 77.5 % (262 of 338) | 91.6 % (109 of 119) | 64.0 % (105 of 164) | 87.3 % (48 of 55) |
Sidechain | 96.3 % (340 of 353) | 94.8 % (200 of 211) | 98.5 % (134 of 136) | 100.0 % (6 of 6) |
Aromatic | 95.7 % (67 of 70) | 91.4 % (32 of 35) | 100.0 % (35 of 35) | |
Methyl | 96.3 % (52 of 54) | 92.6 % (25 of 27) | 100.0 % (27 of 27) |
1. Single-chain Insulin
FVNQHLCGSD LVEALYLVCG ERGFFYTDPT GGGPRRGIVE QCCHSICSLY QLENYCNSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Single Chain Insulin | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18654_2lwz.nef |
Input source #2: Coordindates | 2lwz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:7:CYS:SG | A:43:CYS:SG | oxidized, CA 53.78, CB 47.7 ppm | oxidized, CA 56.95, CB 38.79 ppm | 2.021 |
A:19:CYS:SG | A:56:CYS:SG | oxidized, CA 53.94, CB 36.42 ppm | oxidized, CA 53.24, CB 35.52 ppm | 2.02 |
A:42:CYS:SG | A:47:CYS:SG | oxidized, CA 59.09, CB 38.1 ppm | unknown | 2.018 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------- FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 57 | 0 | 0 | 100.0 |
Content subtype: combined_18654_2lwz.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------- FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN |||||||||||||||||||||||||||||||||||||||||||||| |||||||||| FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSI.SLYQLENYCN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 330 | 314 | 95.2 |
13C chemical shifts | 250 | 191 | 76.4 |
15N chemical shifts | 64 | 54 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 119 | 111 | 93.3 |
13C chemical shifts | 114 | 56 | 49.1 |
15N chemical shifts | 55 | 48 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 203 | 96.2 |
13C chemical shifts | 136 | 135 | 99.3 |
15N chemical shifts | 9 | 6 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 27 | 100.0 |
13C chemical shifts | 27 | 27 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 32 | 91.4 |
13C chemical shifts | 35 | 35 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50------- FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN |||||||||||||||||||||||||||||||||||||||||||||| |||||||||| FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSI.SLYQLENYCN
Dihedral angle restraints
--------10--------20--------30--------40--------50------- FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN