Solution structure of the Get5 ubiquitin-like domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 75.4 % (804 of 1066) | 79.6 % (441 of 554) | 67.4 % (285 of 423) | 87.6 % (78 of 89) |
Backbone | 76.3 % (392 of 514) | 86.0 % (147 of 171) | 66.5 % (173 of 260) | 86.7 % (72 of 83) |
Sidechain | 76.8 % (490 of 638) | 76.8 % (294 of 383) | 76.3 % (190 of 249) | 100.0 % (6 of 6) |
Aromatic | 16.2 % (12 of 74) | 32.4 % (12 of 37) | 0.0 % (0 of 37) | |
Methyl | 96.6 % (112 of 116) | 96.6 % (56 of 58) | 96.6 % (56 of 58) |
1. Get5
MVHLTLKKIQ APKFSIEHDF SPSDTILQIK QHLISEEKAS HISEIKLLLK GKVLHDNLFL SDLKVTPANS TITVMIKPNL EHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.778 ppm | internal | indirect | 0.251457 |
1H | water | protons | 4.778 ppm | internal | direct | 1.0 |
15N | water | protons | 4.778 ppm | internal | indirect | 0.1013401 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.778 ppm | internal | indirect | 0.251457 |
1H | water | protons | 4.778 ppm | internal | direct | 1.0 |
15N | water | protons | 4.778 ppm | internal | indirect | 0.1013401 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.778 ppm | internal | indirect | 0.251457 |
1H | water | protons | 4.778 ppm | internal | direct | 1.0 |
15N | water | protons | 4.778 ppm | internal | indirect | 0.1013401 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297.5 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18669_2lxa.nef |
Input source #2: Coordindates | 2lxa.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------80--------90-------100-------110-------120-------130-------140-------150--------- MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 87 | 0 | 0 | 100.0 |
Content subtype: combined_18669_2lxa.nef
Assigned chemical shifts
------80--------90-------100-------110-------120-------130-------140-------150--------- MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | .VHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNL......H
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 554 | 438 | 79.1 |
13C chemical shifts | 423 | 270 | 63.8 |
15N chemical shifts | 89 | 78 | 87.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 171 | 147 | 86.0 |
13C chemical shifts | 174 | 80 | 46.0 |
15N chemical shifts | 83 | 72 | 86.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 383 | 291 | 76.0 |
13C chemical shifts | 249 | 190 | 76.3 |
15N chemical shifts | 6 | 6 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 56 | 93.3 |
13C chemical shifts | 60 | 56 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 12 | 32.4 |
13C chemical shifts | 37 | 0 | 0.0 |
Distance restraints
------80--------90-------100-------110-------120-------130-------140-------150--------- MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNL ------80--------90-------100-------110-------120-------130-------140-------150--
Dihedral angle restraints
------80--------90-------100-------110-------120-------130-------140-------150--------- MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VHLTLKK....KFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKP ------80--------90-------100-------110-------120-------130-------140-------150