BMRBj - BMREntryMaster

Found 1 Document (1.179 seconds)

BMRB: 18671

2LXC

Solution structure of the complex between the Sgt2 homodimerization domain and the Get5 UBL domain

Authors

Chartron, J.W., VanderVelde, D.G., Clemons, W.M.

Assembly

complex between the Sgt2 homodimerization domain and the Get5 UBL domain

Entity

1. Get5 (polymer, Thiol state: not present), 81 monomers, 9155.672 Da Detail

MVHLTLKKIQ APKFSIEHDF SPSDTILQIK QHLISEEKAS HISEIKLLLK GKVLHDNLFL SDLKVTPANS TITVMIKPNL E

2. Sgt2 (polymer), 74 monomers, 7882.664 × 2 Da Detail

SVDSASKEEI AALIVNYFSS IVEKKEISED GADSLNVAMD CISEAFGFER EAVSGILGKS EFKGQHLADI LNSA

Total weight

24921.0 Da

Max. entity weight

9155.672 Da

Source organism

Saccharomyces cerevisiae

Exptl. method

solution NMR

Refine. method

simulated annealing, experimentally driven docking

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 93.5 %, Completeness: 78.3 %, Completeness (bb): 81.0 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	78.3 % (1413 of 1805)	79.5 % (742 of 933)	74.8 % (532 of 711)	86.3 % (139 of 161)
Backbone	81.0 % (747 of 922)	86.2 % (269 of 312)	75.6 % (347 of 459)	86.8 % (131 of 151)
Sidechain	76.9 % (794 of 1032)	76.2 % (473 of 621)	78.1 % (313 of 401)	80.0 % (8 of 10)
Aromatic	51.0 % (52 of 102)	68.6 % (35 of 51)	33.3 % (17 of 51)
Methyl	83.2 % (168 of 202)	83.2 % (84 of 101)	83.2 % (84 of 101)

1. Get5

MVHLTLKKIQ APKFSIEHDF SPSDTILQIK QHLISEEKAS HISEIKLLLK GKVLHDNLFL SDLKVTPANS TITVMIKPNL E

2. Sgt2

SVDSASKEEI AALIVNYFSS IVEKKEISED GADSLNVAMD CISEAFGFER EAVSGILGKS EFKGQHLADI LNSA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1, Details Saturated complex between labeled Sgt2 and unlabeled Get5. Two monomers of Sgt form a homodimer, that binds one monomer of Get5.

#	Name	Isotope labeling	Concentration
1	Get5	natural abundance	1 mM
2	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
3	Bis-Tris	natural abundance	10 mM
4	L-arginine	natural abundance	50 mM
5	L-glutamic acid	natural abundance	50 mM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

Sample #2

#	Name	Isotope labeling	Concentration
9	Get5	natural abundance	1 mM
10	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
11	Bis-Tris	natural abundance	10 mM
12	L-arginine	natural abundance	50 mM
13	L-glutamic acid	natural abundance	50 mM
14	sodium azide	natural abundance	0.02 %
15	polyacrylamide	natural abundance	3.5 %
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1, Details Saturated complex between unlabeled Sgt2 and labeled Get5. Two monomers of Sgt form a homodimer, that binds one monomer of Get5.

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

Sample #4

#	Name	Isotope labeling	Concentration
26	Get5	[U-100% 13C; U-100% 15N]	1 mM
27	Sgt2	natural abundance	2 mM
28	Bis-Tris	natural abundance	10 mM
29	L-arginine	natural abundance	50 mM
30	L-glutamic acid	natural abundance	50 mM
31	sodium azide	natural abundance	0.02 %
32	polyacrylamide	natural abundance	3.5 %
33	H2O	natural abundance	90 %
34	D2O	natural abundance	10 %

Protein Blocks Logo

Calculated from 10 models in PDB: 2LXC, Strand ID: A, B, C Detail

Release date

2012-11-19

Citation

Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface
Chartron, J.W., VanderVelde, D.G., Clemons, W.M.
Cell Rep. (2012), 2, 1620-1632, PubMed 23142665 , DOI 10.1016/j.celrep.2012.10.010 , Abstract

Related entities 1. Get5, : 2 : 44 entities Detail

Related entities 2. Sgt2, : 1 : 1 : 4 : 3 entities Detail

Interaction partners 1. Get5, : 15 interactors Detail

More details for 15 interactors identified by 5 citations

Experiments performed 14 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1, Details Saturated complex between labeled Sgt2 and unlabeled Get5. Two monomers of Sgt form a homodimer, that binds one monomer of Get5.

#	Name	Isotope labeling	Concentration
1	Get5	natural abundance	1 mM
2	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
3	Bis-Tris	natural abundance	10 mM
4	L-arginine	natural abundance	50 mM
5	L-glutamic acid	natural abundance	50 mM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

2 3D 1H-15N NOESY

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	Get5	natural abundance	1 mM
2	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
3	Bis-Tris	natural abundance	10 mM
4	L-arginine	natural abundance	50 mM
5	L-glutamic acid	natural abundance	50 mM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

3 3D 1H-15N TOCSY

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	Get5	natural abundance	1 mM
2	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
3	Bis-Tris	natural abundance	10 mM
4	L-arginine	natural abundance	50 mM
5	L-glutamic acid	natural abundance	50 mM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

4 2D 1H-13C HSQC aliphatic

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	Get5	natural abundance	1 mM
2	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
3	Bis-Tris	natural abundance	10 mM
4	L-arginine	natural abundance	50 mM
5	L-glutamic acid	natural abundance	50 mM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

5 2D 1H-13C HSQC aromatic

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	Get5	natural abundance	1 mM
2	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
3	Bis-Tris	natural abundance	10 mM
4	L-arginine	natural abundance	50 mM
5	L-glutamic acid	natural abundance	50 mM
6	sodium azide	natural abundance	0.02 %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

6 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1, Details Saturated complex between unlabeled Sgt2 and labeled Get5. Two monomers of Sgt form a homodimer, that binds one monomer of Get5.

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

7 3D HNCACB

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

8 3D HNCO

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

9 3D (H)CCH-TOCSY

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

10 3D HCCH-TOCSY

Instrument

Varian INOVA - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

11 3D 1H-15N NOESY

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

12 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
18	Get5	[U-100% 13C; U-100% 15N]	1 mM
19	Sgt2	natural abundance	2 mM
20	Bis-Tris	natural abundance	10 mM
21	L-arginine	natural abundance	50 mM
22	L-glutamic acid	natural abundance	50 mM
23	sodium azide	natural abundance	0.02 %
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

13 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1, Details Saturated complex between labeled Sgt2 and unlabeled Get5. Two monomers of Sgt form a homodimer, that binds one monomer of Get5.

#	Name	Isotope labeling	Concentration
9	Get5	natural abundance	1 mM
10	Sgt2	[U-100% 13C; U-100% 15N]	2 mM
11	Bis-Tris	natural abundance	10 mM
12	L-arginine	natural abundance	50 mM
13	L-glutamic acid	natural abundance	50 mM
14	sodium azide	natural abundance	0.02 %
15	polyacrylamide	natural abundance	3.5 %
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

14 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1, Details Saturated complex between unlabeled Sgt2 and labeled Get5. Two monomers of Sgt form a homodimer, that binds one monomer of Get5.

#	Name	Isotope labeling	Concentration
26	Get5	[U-100% 13C; U-100% 15N]	1 mM
27	Sgt2	natural abundance	2 mM
28	Bis-Tris	natural abundance	10 mM
29	L-arginine	natural abundance	50 mM
30	L-glutamic acid	natural abundance	50 mM
31	sodium azide	natural abundance	0.02 %
32	polyacrylamide	natural abundance	3.5 %
33	H2O	natural abundance	90 %
34	D2O	natural abundance	10 %

NMR combined restraints 8 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_18671_2lxc.nef
Input source #2: Coordindates	2lxc.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Error

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

------80--------90-------100-------110-------120-------130-------140-------150---
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE
--------10--------20--------30--------40--------50--------60--------70--------80-

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

-0--------10--------20--------30--------40--------50--------60--------70--
SVDSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHLADILNSA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SVDSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHLADILNSA
--------10--------20--------30--------40--------50--------60--------70----

Entity_assembly_ID (NMR): C vs Auth_asym_ID (model): C

-0--------10--------20--------30--------40--------50--------60--------70--
SVDSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHLADILNSA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SVDSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHLADILNSA
--------10--------20--------30--------40--------50--------60--------70----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Sequence coverage (%)
A	A	81	100.0
B	B	74	100.0
C	C	74	100.0

Content subtype: combined_18671_2lxc.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1424		100.0 (chain: A, length: 81), 83.8 (chain: B, length: 74)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	Warning	5939 (1)	noe	100.0 (chain: A, length: 81), 83.8 (chain: B, length: 74), 83.8 (chain: C, length: 74)
3	Distance restraints	CNS/XPLOR_distance_constraints_7	Warning	46 (1)	noe	8.6 (chain: A, length: 81), 6.8 (chain: B, length: 74), 6.8 (chain: C, length: 74)
4	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	152 (1)	hbond	42.0 (chain: A, length: 81), 44.6 (chain: B, length: 74), 44.6 (chain: C, length: 74)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	330 (330)	.	91.4 (chain: A, length: 81), 73.0 (chain: B, length: 74), 73.0 (chain: C, length: 74)
1	RDC restraints	CNS/XPLOR_dipolar_coupling_6	OK	97 (97)	.	55.6 (chain: A, length: 81), 35.1 (chain: B, length: 74), 35.1 (chain: C, length: 74)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 100.0%
  - Entity_assembly_ID: B, Chain length: 74, Sequence coverage: 83.8%
- Total number of assignments
  - ¹H chemical shifts: 766
  - ¹³C chemical shifts: 522
  - ¹⁵N chemical shifts: 136
- Completeness of assignments
  - Entity_assemble_ID: A
  - Entity_assemble_ID: B
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
  - Chain_ID: B

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
75	HIS	HD1	7.352

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	518	467	90.2
¹³C chemical shifts	393	351	89.3
¹⁵N chemical shifts	83	82	98.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	159	158	99.4
¹³C chemical shifts	162	156	96.3
¹⁵N chemical shifts	77	76	98.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	359	309	86.1
¹³C chemical shifts	231	195	84.4
¹⁵N chemical shifts	6	6	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	60	56	93.3
¹³C chemical shifts	60	56	93.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	25	15	60.0
¹³C chemical shifts	25	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	415	298	71.8
¹³C chemical shifts	318	171	53.8
¹⁵N chemical shifts	79	54	68.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	153	117	76.5
¹³C chemical shifts	148	51	34.5
¹⁵N chemical shifts	74	52	70.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	262	181	69.1
¹³C chemical shifts	170	120	70.6
¹⁵N chemical shifts	5	2	40.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	35	79.5
¹³C chemical shifts	44	30	68.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	26	20	76.9
¹³C chemical shifts	26	17	65.4

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 100.0%
  - Entity_assembly_ID: B, Chain length: 74, Sequence coverage: 83.8%
  - Entity_assembly_ID: C, Chain length: 74, Sequence coverage: 83.8%
- Total number of restraints: 5928
- Weight of restraints: 1.0 (5928)
- Potential type of restraints: square-well-parabolic (5928)
- Range of distance target values: 1.57, 7.61 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
  - Chain_ID: C
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_7
  - Status: Warning
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 8.6%
    - Entity_assembly_ID: B, Chain length: 74, Sequence coverage: 6.8%
    - Entity_assembly_ID: C, Chain length: 74, Sequence coverage: 6.8%
  - Total number of restraints: 45
  - Weight of restraints: 1.0 (45)
  - Potential type of restraints: square-well-parabolic (45)
  - Range of distance target values: 3.0, 3.0 (Å)
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
    - Chain_ID: C
  - Distance restraints on contact map
  - Saveframe: CNS/XPLOR_distance_constraints_3
    - Status: OK
    - Experiment type: hbond
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 42.0%
      - Entity_assembly_ID: B, Chain length: 74, Sequence coverage: 44.6%
      - Entity_assembly_ID: C, Chain length: 74, Sequence coverage: 44.6%
    - Total number of restraints: 152
    - Weight of restraints: 1.0 (152)
    - Potential type of restraints: square-well-parabolic (152)
    - Range of distance target values: 2.05, 3.05 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
      - Chain_ID: B
      - Chain_ID: C
    - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 91.4%
  - Entity_assembly_ID: B, Chain length: 74, Sequence coverage: 73.0%
  - Entity_assembly_ID: C, Chain length: 74, Sequence coverage: 73.0%
- Total number of restraints: 330
- Total number of restraints per polymer type: 330
- Weight of restraints: 1.0 (330)
- Potential type of restraints: square-well-parabolic (330)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A
  - Chain_ID: B
  - Chain_ID: C

RDC restraints

Saveframe: CNS/XPLOR_dipolar_coupling_6
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 55.6%
  - Entity_assembly_ID: B, Chain length: 74, Sequence coverage: 35.1%
  - Entity_assembly_ID: C, Chain length: 74, Sequence coverage: 35.1%
- Total number of restraints: 97
- Potential type of restraints: undefined (97)
- Range of observed RDC values: 100.0, -100.0 (Hz)
- RDC restraints per residue
  - Chain_ID: A
    None

Keywords four-helix bundle, GET pathway, protein-protein interaction, ubiquitin-like domain

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.179 seconds)

BMRB: 18671

Sample #1

Sample #2

Sample #3

Sample #4

Related entities 1. Get5, : 2 : 44 entities Detail

Related entities 2. Sgt2, : 1 : 1 : 4 : 3 entities Detail

Interaction partners 1. Get5, : 15 interactors Detail

Experiments performed 14 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 8 contents Detail