Solution NMR structure of a potential acylphosphatase from Giardia lamblia, Seattle Structural Genomics Center for Infectious Disease target GilaA.01396.a
MAHHHHHHMG TLEAQTQGPG SMQGSMPSSS EDVTTLCYRV TGKVQGVFFR KYTKKEADAL SLVGYVTNNE DGSVSGVVQG PKEQVDAFVK YLHKGSPKSV VKKVSIHASS RVDADGFEIR R
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.8 % (1014 of 1356) | 71.8 % (504 of 702) | 77.5 % (410 of 529) | 80.0 % (100 of 125) |
Backbone | 79.4 % (570 of 718) | 76.0 % (190 of 250) | 81.2 % (285 of 351) | 81.2 % (95 of 117) |
Sidechain | 71.5 % (534 of 747) | 68.8 % (311 of 452) | 76.0 % (218 of 287) | 62.5 % (5 of 8) |
Aromatic | 66.3 % (69 of 104) | 71.2 % (37 of 52) | 61.5 % (32 of 52) | |
Methyl | 86.2 % (100 of 116) | 84.5 % (49 of 58) | 87.9 % (51 of 58) |
1. entity
MAHHHHHHMG TLEAQTQGPG SMQGSMPSSS EDVTTLCYRV TGKVQGVFFR KYTKKEADAL SLVGYVTNNE DGSVSGVVQG PKEQVDAFVK YLHKGSPKSV VKKVSIHASS RVDADGFEIR RSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
8 | sodium chloride | natural abundance | 100 (±2.0) mM | |
9 | TRIS | natural abundance | 20 (±0.5) mM | |
10 | DTT | natural abundance | 1 (±0.1) mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | TRIS | natural abundance | 20 (±0.5) mM | |
4 | DTT | natural abundance | 1 (±0.1) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GilaA | [U-99% 13C; U-99% 15N] | 1.5 (±0.2) mM | |
8 | sodium chloride | natural abundance | 100 (±2.0) mM | |
9 | TRIS | natural abundance | 20 (±0.5) mM | |
10 | DTT | natural abundance | 1 (±0.1) mM | |
11 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18673_2lxf.nef |
Input source #2: Coordindates | 2lxf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMQGSMPSSSEDVTTLCYRVTGKVQGVFFRKYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAHHHHHHMGTLEAQTQGPGSMQGSMPSSSEDVTTLCYRVTGKVQGVFFRKYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV -------110-------120- VKKVSIHASSRVDADGFEIRR ||||||||||||||||||||| VKKVSIHASSRVDADGFEIRR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_18673_2lxf.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMQGSMPSSSEDVTTLCYRVTGKVQGVFFRKYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV | |||||||||||||||||||||| ||||||||||||||| ||| ||||||||||||||||||||||||||||||||||||||||||||||||| .A......MGTLEAQTQGPGSMQGSMPSSS.DVTTLCYRVTGKVQG.FFR.YTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV -------110-------120- VKKVSIHASSRVDADGFEIRR ||||||||||||||||||||| VKKVSIHASSRVDADGFEIRR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 702 | 494 | 70.4 |
13C chemical shifts | 529 | 409 | 77.3 |
15N chemical shifts | 130 | 99 | 76.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 250 | 188 | 75.2 |
13C chemical shifts | 242 | 189 | 78.1 |
15N chemical shifts | 117 | 95 | 81.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 452 | 306 | 67.7 |
13C chemical shifts | 287 | 220 | 76.7 |
15N chemical shifts | 13 | 4 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 52 | 83.9 |
13C chemical shifts | 62 | 53 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 34 | 65.4 |
13C chemical shifts | 52 | 32 | 61.5 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMQGSMPSSSEDVTTLCYRVTGKVQGVFFRKYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV |||||||||||| ||||||| |||||||||||| | ||| ||||||||||||||||||||||||||||||||||||||||||||||||| .........GTLEAQTQGPGS.QGSMPSS..DVTTLCYRVTGK.Q..FFR.YTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV -------110-------120- VKKVSIHASSRVDADGFEIRR ||||||||||||||||||||| VKKVSIHASSRVDADGFEIRR
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMQGSMPSSSEDVTTLCYRVTGKVQGVFFRKYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV ||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| ..............................EDVTTLCYRVTGKVQ.....KYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSV -------110-------120- VKKVSIHASSRVDADGFEIRR |||||||||||||| |||||| VKKVSIHASSRVDA.GFEIRR