LIP5(MIT)2
MAALAPLPPL PAQFKSIQHH LRTAQEHDKR DPVVAYYCRL YAMQTGMKID SKTPECRKFL SKLMDQLEAL KKQLGDNEAI TQEIVGCAHL ENYALKMFLY ADNEDRAGRF HKNMIKSFYT ASLLIDVITV FGELTDENVK HRKYARWKAT YIHNCLKNGE TPQAGPVGIE EDNDIEENED AGA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.1 % (1728 of 2156) | 86.3 % (972 of 1126) | 68.1 % (570 of 837) | 96.4 % (186 of 193) |
Backbone | 83.7 % (906 of 1082) | 99.7 % (366 of 367) | 68.7 % (371 of 540) | 96.6 % (169 of 175) |
Sidechain | 79.0 % (986 of 1248) | 79.8 % (606 of 759) | 77.1 % (363 of 471) | 94.4 % (17 of 18) |
Aromatic | 68.3 % (112 of 164) | 86.6 % (71 of 82) | 49.4 % (40 of 81) | 100.0 % (1 of 1) |
Methyl | 99.5 % (191 of 192) | 100.0 % (96 of 96) | 99.0 % (95 of 96) |
1. LIP5
MAALAPLPPL PAQFKSIQHH LRTAQEHDKR DPVVAYYCRL YAMQTGMKID SKTPECRKFL SKLMDQLEAL KKQLGDNEAI TQEIVGCAHL ENYALKMFLY ADNEDRAGRF HKNMIKSFYT ASLLIDVITV FGELTDENVK HRKYARWKAT YIHNCLKNGE TPQAGPVGIE EDNDIEENED AGASolvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 900 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-183) | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | EDTA | natural abundance | 0.1 mM | |
6 | H2O | natural abundance | 92 % | |
7 | D2O | natural abundance | 8 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18681_2lxl.nef |
Input source #2: Coordindates | 2lxl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------170-------180--- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 183 | 0 | 0 | 100.0 |
Content subtype: combined_18681_2lxl.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------170-------180--- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1126 | 956 | 84.9 |
13C chemical shifts | 837 | 522 | 62.4 |
15N chemical shifts | 201 | 185 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 367 | 366 | 99.7 |
13C chemical shifts | 366 | 171 | 46.7 |
15N chemical shifts | 175 | 168 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 759 | 590 | 77.7 |
13C chemical shifts | 471 | 351 | 74.5 |
15N chemical shifts | 26 | 17 | 65.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 102 | 102 | 100.0 |
13C chemical shifts | 102 | 101 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 71 | 86.6 |
13C chemical shifts | 81 | 40 | 49.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------170-------180--- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180--- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAG -------110-------120-------130-------140-------150-------160-------170-------180--