LIP5-CHMP5
MAALAPLPPL PAQFKSIQHH LRTAQEHDKR DPVVAYYCRL YAMQTGMKID SKTPECRKFL SKLMDQLEAL KKQLGDNEAI TQEIVGCAHL ENYALKMFLY ADNEDRAGRF HKNMIKSFYT ASLLIDVITV FGELTDENVK HRKYARWKAT YIHNCLKNGE TPQAGPVG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.5 % (2075 of 2609) | 85.8 % (1164 of 1357) | 67.1 % (683 of 1018) | 97.4 % (228 of 234) |
Backbone | 82.4 % (1104 of 1340) | 98.0 % (446 of 455) | 66.8 % (447 of 669) | 97.7 % (211 of 216) |
Sidechain | 79.0 % (1173 of 1484) | 79.6 % (718 of 902) | 77.7 % (438 of 564) | 94.4 % (17 of 18) |
Aromatic | 60.3 % (111 of 184) | 72.8 % (67 of 92) | 47.3 % (43 of 91) | 100.0 % (1 of 1) |
Methyl | 100.0 % (240 of 240) | 100.0 % (120 of 120) | 100.0 % (120 of 120) |
1. LIP5(1-168)
MAALAPLPPL PAQFKSIQHH LRTAQEHDKR DPVVAYYCRL YAMQTGMKID SKTPECRKFL SKLMDQLEAL KKQLGDNEAI TQEIVGCAHL ENYALKMFLY ADNEDRAGRF HKNMIKSFYT ASLLIDVITV FGELTDENVK HRKYARWKAT YIHNCLKNGE TPQAGPVG2. CHMP5(139-195)
GHMEDANEIQ EALSRSYGTP ELDEDDLEAE LDALGDELLA DEDSSYLDEA ASAPAIPEGSolvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian DirectDrive - 900 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian DirectDrive - 900 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Varian DirectDrive - 900 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LIP5(1-168) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | CHMP5(139-195) | [U-100% 13C; U-100% 15N] | 0.5 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | DTT | natural abundance | 0.5 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18682_2lxm.nef |
Input source #2: Coordindates | 2lxm.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVG
---140-----150-------160-------170-------180-------190----- GHMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEG --------10--------20--------30--------40--------50---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 168 | 0 | 0 | 100.0 |
B | B | 59 | 0 | 0 | 100.0 |
Content subtype: combined_18682_2lxm.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVG ||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| |||||| ADNEDRAGRFH.NMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGET.QAGPVG
---140-----150-------160-------170-------180-------190----- GHMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
122 | SER | HG | 5.757 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1049 | 862 | 82.2 |
13C chemical shifts | 782 | 490 | 62.7 |
15N chemical shifts | 184 | 173 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 330 | 98.2 |
13C chemical shifts | 336 | 164 | 48.8 |
15N chemical shifts | 160 | 158 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 713 | 532 | 74.6 |
13C chemical shifts | 446 | 326 | 73.1 |
15N chemical shifts | 24 | 15 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 94 | 97.9 |
13C chemical shifts | 96 | 94 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 62 | 75.6 |
13C chemical shifts | 81 | 37 | 45.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 308 | 284 | 92.2 |
13C chemical shifts | 236 | 161 | 68.2 |
15N chemical shifts | 59 | 55 | 93.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 119 | 116 | 97.5 |
13C chemical shifts | 118 | 59 | 50.0 |
15N chemical shifts | 56 | 53 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 168 | 88.9 |
13C chemical shifts | 118 | 102 | 86.4 |
15N chemical shifts | 3 | 2 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 31 | 100.0 |
13C chemical shifts | 31 | 31 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 5 | 50.0 |
13C chemical shifts | 10 | 3 | 30.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVG ||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| |||||| ADNEDRAGRFH.NMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGET.QAGPVG
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| |||||||||||||||||||||||| MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKI....PECRKFLSKLMDQLEALKKQLG.NEAITQEIVGCAHLENYALKMFLY -------110-------120-------130-------140-------150-------160-------- ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVG