The solution structure of XIAP(RING)-binding domain of human XAF1
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | metal coordination | sing | 1:CYS21:SG | 2:ZN1:ZN |
2 | metal coordination | sing | 1:CYS24:SG | 2:ZN1:ZN |
3 | metal coordination | sing | 1:CYS40:SG | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.4 % (620 of 650) | 95.1 % (328 of 345) | 95.5 % (235 of 246) | 96.6 % (57 of 59) |
Backbone | 96.0 % (311 of 324) | 96.4 % (107 of 111) | 95.7 % (154 of 161) | 96.2 % (50 of 52) |
Sidechain | 95.5 % (360 of 377) | 94.4 % (221 of 234) | 97.1 % (132 of 136) | 100.0 % (7 of 7) |
Aromatic | 81.8 % (36 of 44) | 81.8 % (18 of 22) | 81.0 % (17 of 21) | 100.0 % (1 of 1) |
Methyl | 100.0 % (48 of 48) | 100.0 % (24 of 24) | 100.0 % (24 of 24) |
1. entity 1
GSEFTSSPRG DKAAYDILRR CSQCGILLPL PILNQHQEKC RWLASSKGKQ VRNFSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013 |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz Equipped with a TCI cyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XAF1 | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | BisTris-HCl | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | D10 | 5 mM | |
5 | PMSF | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18700_2lxw.nef |
Input source #2: Coordindates | 2lxw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:21:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:40:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:24:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:36:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50----- GSEFTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS ||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSEFTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 55 | 0 | 0 | 100.0 |
Content subtype: combined_18700_2lxw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50----- GSEFTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS ||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSEFTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 345 | 334 | 96.8 |
13C chemical shifts | 246 | 237 | 96.3 |
15N chemical shifts | 64 | 57 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 111 | 109 | 98.2 |
13C chemical shifts | 110 | 105 | 95.5 |
15N chemical shifts | 52 | 50 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 234 | 225 | 96.2 |
13C chemical shifts | 136 | 132 | 97.1 |
15N chemical shifts | 12 | 7 | 58.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 24 | 100.0 |
13C chemical shifts | 24 | 24 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 18 | 81.8 |
13C chemical shifts | 21 | 17 | 81.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50----- GSEFTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS ||| ||||||||||||||||||||||||||||||||||||||||||||||||| ..EFT.SPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS