The budding yeast chaperone Scm3 recognizes the partially unfolded dimer of the centromere-specific Cse4/H4 histone variant
LISKIPFARL VKEVTDEFTT KDQDLRWQSM AIMALQEASE AYLVGLLEHT NLLALHLVPR GSKRISGLIY EEVRAVLKSF LESVIRDSVT YTEHAKRKTV TSLDVVYALK RQGRTLYGFG G
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.3 % (1282 of 1436) | 90.8 % (673 of 741) | 86.3 % (492 of 570) | 93.6 % (117 of 125) |
Backbone | 94.0 % (679 of 722) | 93.1 % (230 of 247) | 94.7 % (337 of 356) | 94.1 % (112 of 119) |
Sidechain | 86.0 % (712 of 828) | 89.7 % (443 of 494) | 80.5 % (264 of 328) | 83.3 % (5 of 6) |
Aromatic | 45.2 % (47 of 104) | 78.8 % (41 of 52) | 11.8 % (6 of 51) | 0.0 % (0 of 1) |
Methyl | 93.0 % (160 of 172) | 93.0 % (80 of 86) | 93.0 % (80 of 86) |
1. sC4
LISKIPFARL VKEVTDEFTT KDQDLRWQSM AIMALQEASE AYLVGLLEHT NLLALHLVPR GSKRISGLIY EEVRAVLKSF LESVIRDSVT YTEHAKRKTV TSLDVVYALK RQGRTLYGFG GSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 13C/15N labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
8 | D2O | natural abundance | 100 (±0.05) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sC4 | natural abundance | 0.8 (±0.05) mM | |
10 | D2O | natural abundance | 100 (±0.05) % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | sC4 | Carbon | 0.0 ppm | external | indirect | 1.0 |
1H | sC4 | protons | 0.0 ppm | external | direct | 1.0 |
15N | sC4 | nitrogen | 0.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | sC4 | Carbon | 0.0 ppm | external | indirect | 1.0 |
1H | sC4 | protons | 0.0 ppm | external | direct | 1.0 |
15N | sC4 | nitrogen | 0.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | sC4 | Carbon | 0.0 ppm | external | indirect | 1.0 |
1H | sC4 | protons | 0.0 ppm | external | direct | 1.0 |
15N | sC4 | nitrogen | 0.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | sC4 | Carbon | 0.0 ppm | external | indirect | 1.0 |
1H | sC4 | protons | 0.0 ppm | external | direct | 1.0 |
15N | sC4 | nitrogen | 0.0 ppm | external | indirect | 1.0 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sC4 | natural abundance | 0.8 (±0.05) mM | |
10 | D2O | natural abundance | 100 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 15N, 13C/15N or 13C/15N/D labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sC4 | [U-100% 15N] | 0.8 (±0.05) mM | |
2 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
3 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
4 | sC4 | [U-13C; U-15N; U-2H] | 0.8 (±0.05) mM | |
5 | H2O | natural abundance | 90 (±0.05) % | |
6 | D2O | natural abundance | 10 (±0.05) % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 13C/15N labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
8 | D2O | natural abundance | 100 (±0.05) % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 13C/15N labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
8 | D2O | natural abundance | 100 (±0.05) % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 13C/15N labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
8 | D2O | natural abundance | 100 (±0.05) % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 13C/15N labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
8 | D2O | natural abundance | 100 (±0.05) % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sC4 | natural abundance | 0.8 (±0.05) mM | |
10 | D2O | natural abundance | 100 (±0.05) % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308.1 (±0.2) K, pH 5.4 (±0.1), Details 13C/15N labeled single chain Cse4-H4(sC4) in 50 mM MES, pH 5.4, 308.1K.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sC4 | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM | |
8 | D2O | natural abundance | 100 (±0.05) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18713_2ly8.nef |
Input source #2: Coordindates | 2ly8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV -------110-------120- TSLDVVYALKRQGRTLYGFGG ||||||||||||||||||||| TSLDVVYALKRQGRTLYGFGG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_18713_2ly8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| .ISK..FARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGL.YEEVRAVLKSFLESVIRDSVTYTEHAKRKTV -------110-------120- TSLDVVYALKRQGRTLYGFGG ||||||||||||||||||||| TSLDVVYALKRQGRTLYGFGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 741 | 683 | 92.2 |
13C chemical shifts | 570 | 487 | 85.4 |
15N chemical shifts | 134 | 116 | 86.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 247 | 235 | 95.1 |
13C chemical shifts | 242 | 228 | 94.2 |
15N chemical shifts | 119 | 111 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 494 | 448 | 90.7 |
13C chemical shifts | 328 | 259 | 79.0 |
15N chemical shifts | 15 | 5 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 80 | 90.9 |
13C chemical shifts | 88 | 80 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 41 | 78.8 |
13C chemical shifts | 51 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV -------110-------120- TSLDVVYALKRQGRTLYGFGG ||||||||||||||||||||| TSLDVVYALKRQGRTLYGFGG
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV |||||||||||||||| ||||||||||||||||||||| |||||||||||||||||||||||||||| ....IPFARLVKEVTDEFTT........SMAIMALQEASEAYLVGLLEH..................LIYEEVRAVLKSFLESVIRDSVTYTEHA..... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120- TSLDVVYALKRQGRTLYGFGG |||||||||| .SLDVVYALKR -------110-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| LISK.PFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPR.......LIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120- TSLDVVYALKRQGRTLYGFGG |||||||||||||| TSLDVVYALKRQGR -------110----