NMR structure of the protein NP_390345.1 from Bacilus subtilis
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.7 % (942 of 1099) | 88.8 % (515 of 580) | 78.7 % (336 of 427) | 98.9 % (91 of 92) |
Backbone | 83.1 % (429 of 516) | 94.8 % (165 of 174) | 69.8 % (180 of 258) | 100.0 % (84 of 84) |
Sidechain | 88.9 % (593 of 667) | 85.7 % (348 of 406) | 94.1 % (238 of 253) | 87.5 % (7 of 8) |
Aromatic | 96.2 % (100 of 104) | 96.2 % (50 of 52) | 96.0 % (48 of 50) | 100.0 % (2 of 2) |
Methyl | 94.6 % (87 of 92) | 93.5 % (43 of 46) | 95.7 % (44 of 46) |
1. NP 390345.1
GEETPLVTAR HMSKWEEIAV KEAKKRYPLA QVLFKQKVWD RKRKDEAVKQ YHLTLREGSK EFGVFVTISF DPYSQKVNKI AILEEYQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390345.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | calcium chloride | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18732_2lyx.nef |
Input source #2: Coordindates | 2lyx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80------- GEETPLVTARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GEETPLVTARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 87 | 0 | 0 | 100.0 |
Content subtype: combined_18732_2lyx.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------- GEETPLVTARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ |||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GEETPL.TARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
52 | HIS | HD1 | 9.046 |
52 | HIS | ND1 | 199.745 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 580 | 526 | 90.7 |
13C chemical shifts | 427 | 324 | 75.9 |
15N chemical shifts | 97 | 89 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 174 | 165 | 94.8 |
13C chemical shifts | 174 | 86 | 49.4 |
15N chemical shifts | 84 | 82 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 406 | 361 | 88.9 |
13C chemical shifts | 253 | 238 | 94.1 |
15N chemical shifts | 13 | 7 | 53.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 44 | 93.6 |
13C chemical shifts | 47 | 45 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 50 | 96.2 |
13C chemical shifts | 50 | 48 | 96.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80------- GEETPLVTARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ ||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EETPL.TARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ