Ligase 10C
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 1:CYS20:SG | 2:ZN1:ZN |
2 | na | sing | 1:CYS23:SG | 2:ZN1:ZN |
3 | na | sing | 1:CYS57:SG | 2:ZN1:ZN |
4 | na | sing | 1:CYS60:SG | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 61.5 % (590 of 959) | 57.4 % (287 of 500) | 64.2 % (238 of 371) | 73.9 % (65 of 88) |
Backbone | 73.6 % (377 of 512) | 66.5 % (119 of 179) | 77.3 % (194 of 251) | 78.0 % (64 of 82) |
Sidechain | 53.2 % (279 of 524) | 53.0 % (170 of 321) | 54.8 % (108 of 197) | 16.7 % (1 of 6) |
Aromatic | 5.2 % (5 of 96) | 6.3 % (3 of 48) | 4.2 % (2 of 48) | |
Methyl | 77.1 % (37 of 48) | 91.7 % (22 of 24) | 62.5 % (15 of 24) |
1. entity
MGAPVPYPDP LEPRGGKHIC AICGNNAEDY KHTDMDLTYT DRDYKNCESY HKCSDLCQYC RYQKDLAIHH QHHHGGSMGM SGSGTGYSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % | |
10 | NaCl | natural abundance | 150 mM | |
11 | HEPES | natural abundance | 20 mM | |
12 | beta-mercaptoenthanol | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % | |
10 | NaCl | natural abundance | 150 mM | |
11 | HEPES | natural abundance | 20 mM | |
12 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % | |
10 | NaCl | natural abundance | 150 mM | |
11 | HEPES | natural abundance | 20 mM | |
12 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % | |
10 | NaCl | natural abundance | 150 mM | |
11 | HEPES | natural abundance | 20 mM | |
12 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % | |
10 | NaCl | natural abundance | 150 mM | |
11 | HEPES | natural abundance | 20 mM | |
12 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 150 mM | |
5 | HEPES | natural abundance | 20 mM | |
6 | beta-mercaptoenthanol | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18749_2lze.nef |
Input source #2: Coordindates | 2lze.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:18:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:34:ASP:OD1 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:65:ASP:OD2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:20:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:23:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:60:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:57:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:28:GLU:OE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80------- MGAPVPYPDPLEPRGGKHICAICGNNAEDYKHTDMDLTYTDRDYKNCESYHKCSDLCQYCRYQKDLAIHHQHHHGGSMGMSGSGTGY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGAPVPYPDPLEPRGGKHICAICGNNAEDYKHTDMDLTYTDRDYKNCESYHKCSDLCQYCRYQKDLAIHHQHHHGGSMGMSGSGTGY
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 87 | 0 | 0 | 100.0 |
Content subtype: combined_18749_2lze.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------- MGAPVPYPDPLEPRGGKHICAICGNNAEDYKHTDMDLTYTDRDYKNCESYHKCSDLCQYCRYQKDLAIHHQHHHGGSMGMSGSGTGY |||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| |||| ...PVPYPDPLEPRGGKHICAICGNNAEDYKHTDMDLTYTDRDYK.CESYHKCSDLCQYCRYQKDLAIH..............GTGY
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 500 | 276 | 55.2 |
13C chemical shifts | 371 | 227 | 61.2 |
15N chemical shifts | 91 | 61 | 67.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 179 | 118 | 65.9 |
13C chemical shifts | 174 | 125 | 71.8 |
15N chemical shifts | 82 | 61 | 74.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 158 | 49.2 |
13C chemical shifts | 197 | 102 | 51.8 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 22 | 78.6 |
13C chemical shifts | 28 | 13 | 46.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 0 | 0.0 |
13C chemical shifts | 48 | 0 | 0.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80------- MGAPVPYPDPLEPRGGKHICAICGNNAEDYKHTDMDLTYTDRDYKNCESYHKCSDLCQYCRYQKDLAIHHQHHHGGSMGMSGSGTGY ||||||||||| ||||||||||||||||||||||| |||||| ||||||||||||||||||||| || ...PVPYPDPLEPR.GKHICAICGNNAEDYKHTDMDLT.TDRDYK...SYHKCSDLCQYCRYQKDLAIH................GY
Dihedral angle restraints
RDC restraints