Structure of the biofilm matrix promoter AbbA from B. subtilis
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.7 % (720 of 821) | 86.2 % (368 of 427) | 88.1 % (282 of 320) | 94.6 % (70 of 74) |
Backbone | 93.6 % (382 of 408) | 94.3 % (132 of 140) | 93.0 % (186 of 200) | 94.1 % (64 of 68) |
Sidechain | 83.6 % (399 of 477) | 82.2 % (236 of 287) | 85.3 % (157 of 184) | 100.0 % (6 of 6) |
Aromatic | 35.5 % (22 of 62) | 35.5 % (11 of 31) | 35.5 % (11 of 31) | |
Methyl | 100.0 % (82 of 82) | 100.0 % (41 of 41) | 100.0 % (41 of 41) |
1. entity
GSHMRMSLIG ERFTEEEQKL LLNILINHEY AIELLSSEIN DIETGTKNVD GTTYKKLVTL YDRFRFENSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | TRIS | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | TRIS | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | TRIS | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | TRIS | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details 20mM Tris (pH 6.5), 200mM NaCl, 1mM EDTA, 1mM DTT, 0.02% NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, RDC restraints | combined_18753_2lzf.nef |
Input source #2: Coordindates | 2lzf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60-------- GSHMRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN
--------10--------20--------30--------40--------50--------60-------- GSHMRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 68 | 0 | 0 | 100.0 |
B | B | 68 | 0 | 0 | 100.0 |
Content subtype: combined_18753_2lzf.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60-------- GSHMRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| ..HMRMSLIGERFTEEEQKLLLNILINH.YAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 427 | 361 | 84.5 |
13C chemical shifts | 320 | 274 | 85.6 |
15N chemical shifts | 78 | 68 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 140 | 129 | 92.1 |
13C chemical shifts | 136 | 123 | 90.4 |
15N chemical shifts | 68 | 62 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 287 | 232 | 80.8 |
13C chemical shifts | 184 | 151 | 82.1 |
15N chemical shifts | 10 | 6 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 41 | 95.3 |
13C chemical shifts | 43 | 37 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 11 | 35.5 |
13C chemical shifts | 31 | 11 | 35.5 |
RDC restraints
--------10--------20--------30--------40--------50--------60-------- GSHMRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN ||||| |||| || ||| ||| | ||||||||||| | | | | | ||| .....MSLIG..FTEE.QK.LLN........IEL.S.EINDIETGTKN..G.T..K..T..D...FEN