Solution structure of staphylococcal nuclease E43S mutant in the presence of ssDNA and Cd2+
ATSTKKLHKE PATLIKAIDG DTVKLMYKGQ PMTFRLLLVD TPSTKHPKKG VEKYGPEASA FTKKMVENAK KIEVEFDKGQ RTDKYGRGLA YIYADGKMVN EALVRQGLAK VAYVYKPNNT HEQLLRKSEA QAKKEKLNIW SEDNADSGQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (1502 of 1780) | 83.5 % (783 of 938) | 84.5 % (580 of 686) | 89.1 % (139 of 156) |
Backbone | 88.4 % (780 of 882) | 87.7 % (265 of 302) | 89.0 % (389 of 437) | 88.1 % (126 of 143) |
Sidechain | 81.5 % (845 of 1037) | 81.4 % (518 of 636) | 80.9 % (314 of 388) | 100.0 % (13 of 13) |
Aromatic | 72.7 % (80 of 110) | 74.5 % (41 of 55) | 70.4 % (38 of 54) | 100.0 % (1 of 1) |
Methyl | 88.2 % (134 of 152) | 86.8 % (66 of 76) | 89.5 % (68 of 76) |
1. staph nuc E43S
ATSTKKLHKE PATLIKAIDG DTVKLMYKGQ PMTFRLLLVD TPSTKHPKKG VEKYGPEASA FTKKMVENAK KIEVEFDKGQ RTDKYGRGLA YIYADGKMVN EALVRQGLAK VAYVYKPNNT HEQLLRKSEA QAKKEKLNIW SEDNADSGQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 305 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | staph_nuc_E43S | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | CdCl2 | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.2% w/v | |
6 | 8-mer ssDNA(5'-CACTTCAT-3') | natural abundance | 1.5 ~ 2.25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18788_2m00.nef |
Input source #2: Coordindates | 2m00.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN -------110-------120-------130-------140--------- EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ ||||||||||||||||||||||||||||||||||||||||||||||||| EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 149 | 0 | 0 | 100.0 |
Content subtype: combined_18788_2m00.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||||| ||||| || || ||||||||||||||||||||||||||| |||||||||||||||| .TSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFR..LVDTP.......GV..YG.EASAFTKKMVENAKKIEVEFDKGQRTD.YGRGLAYIYADGKMVN -------110-------120-------130-------140--------- EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ |||||||||||| |||||||||||||||||||||||||||||||||||| EALVRQGLAKVA.VYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 938 | 784 | 83.6 |
13C chemical shifts | 686 | 567 | 82.7 |
15N chemical shifts | 161 | 138 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 266 | 88.1 |
13C chemical shifts | 298 | 263 | 88.3 |
15N chemical shifts | 143 | 125 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 636 | 518 | 81.4 |
13C chemical shifts | 388 | 304 | 78.4 |
15N chemical shifts | 18 | 13 | 72.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 68 | 85.0 |
13C chemical shifts | 80 | 68 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 39 | 70.9 |
13C chemical shifts | 54 | 34 | 63.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||| |||||||| ||||| ||| ||||||||||||||||||||||||| |||||||||||||| ....KKLHKEPATLIKAIDG.TVKLMYKG.PMTFR..LVD..................SAFTKKMVENAKKIEVEFDKGQRTD...RGLAYIYADGKMVN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ |||||||| || ||||||||||||||||||||||||||||| .ALVRQGLA.VA..YKPNNTHEQLLRKSEAQAKKEKLNIWSED -------110-------120-------130-------140---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||| |||| | ||||||||||||||||||||||||||| |||||||||||||||| ...TKKLHKEPATLIKAIDGDTVKLMYKGQPMTFR..LVDT.............G.EASAFTKKMVENAKKIEVEFDKGQRTD.YGRGLAYIYADGKMVN -------110-------120-------130-------140--------- EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ |||||||||||| |||||||||||||||||||||||||||||||||||| EALVRQGLAKVA.VYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||||| ||||| ||||||||||||||||||||||||||| |||||||||||||||| .TSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFR..LVDTP..............EASAFTKKMVENAKKIEVEFDKGQRTD.YGRGLAYIYADGKMVN -------110-------120-------130-------140--------- EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ |||||||||||| |||||||||||||||||||||||||||||||| || EALVRQGLAKVA.VYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNA..GQ
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||| |||||||||||||||||||||||||||||||||| |||||||||||||||||||||| ||||||| ||||||||||||| .TSTK..HKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDT...............EASAFTKKMVENAKKIEVEFDK.QRTDKYG.GLAYIYADGKMVN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ ||||||||||||||||||||||||||||||||||||||||| ||| EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS.DNA -------110-------120-------130-------140-----