Structure, phosphorylation and U2AF65 binding of the Nterminal domain of splicing factor 1 during 3 splice site recognition
GAMEQKTVIP GMPTVIPPGL TREQERAYIV QLQIEDLTRK LRTGDLGIPP NPEDRSPSPE PIYNSEGKRL NTREFRTRKK LEEERHNLIT EMVALNPDFK PPADYKPPAT RVSDKVMIPQ D
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.0 % (1399 of 1442) | 96.6 % (745 of 771) | 97.1 % (540 of 556) | 99.1 % (114 of 115) |
Backbone | 98.4 % (683 of 694) | 98.7 % (229 of 232) | 98.3 % (351 of 357) | 98.1 % (103 of 105) |
Sidechain | 96.1 % (829 of 863) | 95.7 % (516 of 539) | 96.5 % (303 of 314) | 100.0 % (10 of 10) |
Aromatic | 95.8 % (46 of 48) | 100.0 % (24 of 24) | 91.7 % (22 of 24) | |
Methyl | 100.0 % (120 of 120) | 100.0 % (60 of 60) | 100.0 % (60 of 60) |
1. entity
GAMEQKTVIP GMPTVIPPGL TREQERAYIV QLQIEDLTRK LRTGDLGIPP NPEDRSPSPE PIYNSEGKRL NTREFRTRKK LEEERHNLIT EMVALNPDFK PPADYKPPAT RVSDKVMIPQ DSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM sodium phosphate (pH 6.5), 50 mM NaCl, 0.1% sodium azide, 1mM DTT and 1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1N | [U-15N] | 100.0 ~ 600.0 uM | |
2 | SF1N | [U-13C; U-15N] | 100.0 ~ 600.0 uM | |
3 | SF1N | [U-13C; U-15N; U-2H] | 100.0 ~ 600.0 uM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | DTT | natural abundance | 1 mM | |
7 | sodium azide | natural abundance | 0.1 % | |
8 | EDTA | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18802_2m09.nef |
Input source #2: Coordindates | 2m09.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---130-------140----- PPADYKPPATRVSDKVMIPQD ||||||||||||||||||||| PPADYKPPATRVSDKVMIPQD -------110-------120-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_18802_2m09.nef
Assigned chemical shifts
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFK ||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ||||||||||||| |||||||||||||| | GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDL.RKLRTGDLGIPPNPEDRSPSPEPIYNSEGKR.NTREFRTRKKLEE.RHNLITEMVALNPD.K ---130-------140----- PPADYKPPATRVSDKVMIPQD ||||||||||||||||||||| PPADYKPPATRVSDKVMIPQD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
29 | GLN | CD | 180.447 |
48 | GLN | CD | 179.961 |
55 | GLN | CD | 179.945 |
57 | GLN | CD | 179.334 |
60 | ASP | CG | 178.873 |
75 | ASN | CG | 177.156 |
78 | ASP | CG | 179.982 |
88 | ASN | CG | 176.888 |
95 | ASN | CG | 177.15 |
111 | ASN | CG | 175.738 |
120 | ASN | CG | 177.922 |
122 | ASP | CG | 179.922 |
128 | ASP | CG | 181.265 |
144 | GLN | CD | 180.909 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 771 | 713 | 92.5 |
13C chemical shifts | 556 | 518 | 93.2 |
15N chemical shifts | 126 | 112 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 232 | 222 | 95.7 |
13C chemical shifts | 242 | 230 | 95.0 |
15N chemical shifts | 105 | 100 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 491 | 91.1 |
13C chemical shifts | 314 | 288 | 91.7 |
15N chemical shifts | 21 | 12 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 58 | 90.6 |
13C chemical shifts | 64 | 57 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 19 | 79.2 |
13C chemical shifts | 24 | 18 | 75.0 |
Distance restraints
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFK ---130-------140----- PPADYKPPATRVSDKVMIPQD ||||||||||||||||||||| PPADYKPPATRVSDKVMIPQD
Dihedral angle restraints
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ....QKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGK.LNTREFRTRKKLEEERHNLITEMVALNPDFK ---130-------140----- PPADYKPPATRVSDKVMIPQD ||||||||| ||||||||| PPADYKPPA...SDKVMIPQD