Solution NMR Structure of Homeobox Domain of Human ALX4, Northeast Structural Genomics Consortium (NESG) Target HR4490C
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 69.9 % (674 of 964) | 68.7 % (355 of 517) | 71.9 % (259 of 360) | 69.0 % (60 of 87) |
Backbone | 71.0 % (318 of 448) | 67.5 % (102 of 151) | 73.5 % (164 of 223) | 70.3 % (52 of 74) |
Sidechain | 69.8 % (411 of 589) | 69.1 % (253 of 366) | 71.4 % (150 of 210) | 61.5 % (8 of 13) |
Aromatic | 81.3 % (78 of 96) | 95.8 % (46 of 48) | 65.2 % (30 of 46) | 100.0 % (2 of 2) |
Methyl | 90.4 % (47 of 52) | 88.5 % (23 of 26) | 92.3 % (24 of 26) |
1. HR4490C
SHMSNKGKKR RNRTTFTSYQ LEELEKVFQK THYPDVYARE QLAMRTDLTE ARVQVWFQNR RAKWRKRERF GQMQQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.6 mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HR4490C | [5% 13C; U-100% 15N] | 0.6 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 5 mM | |
12 | sodium azide | natural abundance | 0.02 % | |
13 | Tris-HCl | natural abundance | 10 mM | |
14 | DSS | natural abundance | 50 uM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.9mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4490C | [U-100% 13C; U-100% 15N] | 0.871 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Tris-HCl | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz HCN, cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.6 mM HR4490C, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HR4490C | [5% 13C; U-100% 15N] | 0.6 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 5 mM | |
12 | sodium azide | natural abundance | 0.02 % | |
13 | Tris-HCl | natural abundance | 10 mM | |
14 | DSS | natural abundance | 50 uM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18805_2m0c.nef |
Input source #2: Coordindates | 2m0c.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70----- SHMSNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMSNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 75 | 0 | 0 | 100.0 |
Content subtype: combined_18805_2m0c.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70----- SHMSNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...............FTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERF --------10--------20--------30--------40--------50--------60--------70
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
46 | THR | HG1 | 4.146 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 517 | 366 | 70.8 |
13C chemical shifts | 360 | 259 | 71.9 |
15N chemical shifts | 98 | 60 | 61.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 151 | 106 | 70.2 |
13C chemical shifts | 150 | 109 | 72.7 |
15N chemical shifts | 74 | 51 | 68.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 366 | 260 | 71.0 |
13C chemical shifts | 210 | 150 | 71.4 |
15N chemical shifts | 24 | 9 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 25 | 86.2 |
13C chemical shifts | 29 | 25 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 46 | 95.8 |
13C chemical shifts | 46 | 30 | 65.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70----- SHMSNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...............FTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERF --------10--------20--------30--------40--------50--------60--------70
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70----- SHMSNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQ ||||||||||||| ||||||||||||||||||||||||||||||| .................SYQLEELEKVFQK....DVYAREQLAMRTDLTEARVQVWFQNRRAKWR --------10--------20--------30--------40--------50--------60-----