Solution structure of U14Ub1, an engineered ubiquitin variant with increased affinity for USP14
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.4 % (831 of 919) | 89.4 % (431 of 482) | 93.2 % (329 of 353) | 84.5 % (71 of 84) |
Backbone | 96.1 % (444 of 462) | 96.9 % (156 of 161) | 96.5 % (218 of 226) | 93.3 % (70 of 75) |
Sidechain | 86.7 % (457 of 527) | 85.7 % (275 of 321) | 91.9 % (181 of 197) | 11.1 % (1 of 9) |
Aromatic | 100.0 % (44 of 44) | 100.0 % (22 of 22) | 100.0 % (21 of 21) | 100.0 % (1 of 1) |
Methyl | 94.6 % (87 of 92) | 95.7 % (44 of 46) | 93.5 % (43 of 46) |
1. entity
GSMQIFVKGL TGKTTTLEVE PSDTIENVKA KIQDKTGLPP DQQRLIFAGK QLEDGRTLSD YNIQKESTLH IVWRLRGGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 125 mM | |
9 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 125 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 125 mM | |
9 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 297 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | U14Ub1 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 125 mM | |
9 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18831_2m0x.nef |
Input source #2: Coordindates | 2m0x.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70------ GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG --------10--------20--------30--------40--------50--------60--------70--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 78 | 0 | 0 | 100.0 |
Content subtype: combined_18831_2m0x.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70------ GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 482 | 428 | 88.8 |
13C chemical shifts | 353 | 328 | 92.9 |
15N chemical shifts | 88 | 70 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 161 | 155 | 96.3 |
13C chemical shifts | 156 | 147 | 94.2 |
15N chemical shifts | 75 | 69 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 273 | 85.0 |
13C chemical shifts | 197 | 181 | 91.9 |
15N chemical shifts | 13 | 1 | 7.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 45 | 95.7 |
13C chemical shifts | 47 | 44 | 93.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 22 | 100.0 |
13C chemical shifts | 21 | 21 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70------ GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MQIFVKGLTG.TTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRL -0--------10--------20--------30--------40--------50--------60--------70---
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70------ GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG ||||| ||||||| ||| ||||||||| || ||| || || ||||||||| ||||| ...QIFVK.....TTTLEVE.SDT.ENVKAKIQD..GL.PDQ.RL....KQ.EDGRTLSDY..QKEST -0--------10--------20--------30--------40--------50--------60------
-0--------10--------20--------30--------40--------50--------60--------70------ GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG ||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| ..MQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAG.QLEDGRTLSDYNIQKESTLHIVW -0--------10--------20--------30--------40--------50--------60--------70-
RDC restraints