HADDOCK structure of GtYybT PAS Homodimer
RGSHMRSLHK ELQQYISNLS YRVKKVSEEA LMQMPIGILL LDEEDKIEWS NRFLAACFKE QTLIGRSLAE LSEPLAAFVK KGKTDEEIIE LNGKQLKVIV HRHERLLYFF DVT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.1 % (1312 of 1395) | 95.5 % (699 of 732) | 91.3 % (496 of 543) | 97.5 % (117 of 120) |
Backbone | 97.3 % (656 of 674) | 96.5 % (221 of 229) | 97.9 % (327 of 334) | 97.3 % (108 of 111) |
Sidechain | 91.9 % (762 of 829) | 95.0 % (478 of 503) | 86.8 % (275 of 317) | 100.0 % (9 of 9) |
Aromatic | 80.4 % (82 of 102) | 92.2 % (47 of 51) | 68.0 % (34 of 50) | 100.0 % (1 of 1) |
Methyl | 98.6 % (136 of 138) | 97.1 % (67 of 69) | 100.0 % (69 of 69) |
1. PAS domain of DHH subfamily 1 protein
RGSHMRSLHK ELQQYISNLS YRVKKVSEEA LMQMPIGILL LDEEDKIEWS NRFLAACFKE QTLIGRSLAE LSEPLAAFVK KGKTDEEIIE LNGKQLKVIV HRHERLLYFF DVTSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Bruker AVANCE II - na MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 50mM phosphate buffer NA; 95% H2O, 5% D2O, pH 6.5, 200mM NaCl, 1x protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PAS domain of DHH subfamily 1 protein | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | phosphate buffer | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 200 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18856_2m1c.nef |
Input source #2: Coordindates | 2m1c.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------1 RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 50-------160- HRHERLLYFFDVT ||||||||||||| HRHERLLYFFDVT -------110---
-50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------1 RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 50-------160- HRHERLLYFFDVT ||||||||||||| HRHERLLYFFDVT -------110---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
B | B | 113 | 0 | 0 | 100.0 |
Content subtype: combined_18856_2m1c.nef
Assigned chemical shifts
-50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------1 RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV 50-------160- HRHERLLYFFDVT ||||||||||||| HRHERLLYFFDVT
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
114 | ARG | HH11 | 6.56 |
114 | ARG | HH12 | 6.56 |
114 | ARG | HH21 | 6.734 |
114 | ARG | HH22 | 6.734 |
115 | SER | HG | 7.221 |
120 | SER | HG | 6.328 |
150 | ARG | HH11 | 6.449 |
150 | ARG | HH12 | 6.449 |
150 | ARG | HH21 | 6.698 |
150 | ARG | HH22 | 6.698 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 732 | 711 | 97.1 |
13C chemical shifts | 543 | 498 | 91.7 |
15N chemical shifts | 127 | 122 | 96.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 225 | 98.3 |
13C chemical shifts | 226 | 222 | 98.2 |
15N chemical shifts | 111 | 108 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 503 | 486 | 96.6 |
13C chemical shifts | 317 | 276 | 87.1 |
15N chemical shifts | 16 | 14 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 72 | 100.0 |
13C chemical shifts | 72 | 72 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 47 | 92.2 |
13C chemical shifts | 50 | 33 | 66.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------1 RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIV | || |||||| | ||| | | ||||||||||| | | ||||||||| ||||||| ||||||| ...H..SL.KELQQY....................I.ILL.D...K.EWSNRFLAACF.........L..L.EPLAAFVKK...DEEIIEL..KQLKVIV -50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------1 50-------160- HRHERLLYFFDVT | |||||| H.....LYFFDV 50-------160