BMRBj - BMREntryMaster

Found 1 Document (0.86 seconds)

BMRB: 18869

2M1L

Solution NMR Structure of Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2, DOC-1R) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8910C

Authors

Ertekin, A., Janjua, H., Kohan, E., Shastry, R., Pederson, K., Prestegard, J.H., Montelione, G.T.

Assembly

HR8910C

Entity

1. HR8910C (polymer), 69 monomers, 7631.688 × 2 Da Detail

SHMAMKPPGA QGSQSTYTDL LSVIEEMGKE IRPTYAGSKS AMERLKRGII HARALVRECL AETERNART

Total weight

15263.376 Da

Max. entity weight

7631.688 Da

Source organism

Homo sapiens

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 98.6 %, Completeness: 91.5 %, Completeness (bb): 96.8 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	91.5 % (710 of 776)	88.7 % (362 of 408)	94.6 % (283 of 299)	94.2 % (65 of 69)
Backbone	96.8 % (395 of 408)	97.1 % (136 of 140)	96.5 % (195 of 202)	97.0 % (64 of 66)
Sidechain	86.8 % (375 of 432)	84.3 % (226 of 268)	91.9 % (148 of 161)	33.3 % (1 of 3)
Aromatic	100.0 % (24 of 24)	100.0 % (12 of 12)	100.0 % (12 of 12)
Methyl	100.0 % (70 of 70)	100.0 % (35 of 35)	100.0 % (35 of 35)

1. HR8910C

SHMAMKPPGA QGSQSTYTDL LSVIEEMGKE IRPTYAGSKS AMERLKRGII HARALVRECL AETERNART

Show sample condition

Sample #1

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

Sample #2

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, 15.0 mg/mL natural abundance HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
9	HR8910C	[U-100% 13C; U-100% 15N]	5.0 mg/mL
10	HR8910C	natural abundance	15.0 mg/mL
11	NaN3	natural abundance	0.02 %
12	DTT	natural abundance	10 mM
13	CaCL2	natural abundance	5 mM
14	NaCL	natural abundance	200 mM
15	MES pH 6.5	natural abundance	20 mM
16	D2O	natural abundance	5 %
17	Proteinase Inhibitors	natural abundance	1 na

Sample #3

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.3 mM [U-100% 15N] HR8910C, pH 6.5 buffer, 4.2% PEG

#	Name	Isotope labeling	Concentration
18	HR8910C	[U-100% 15N]	0.3 mM
19	NaN3	natural abundance	0.02 %
20	DTT	natural abundance	10 mM
21	CaCL2	natural abundance	5 mM
22	NaCL	natural abundance	200 mM
23	MES pH 6.5	natural abundance	20 mM
24	D2O	natural abundance	5 %
25	Proteinase Inhibitors	natural abundance	1 na
26	PEG	natural abundance	4.2 %

Sample #4

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-5%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
27	HR8910C.005	[U-5% 13C; U-100% 15N]	5.0 mg/mL
28	Proteinase Inhibitors	natural abundance	1 na
29	NaN3	natural abundance	0.02 %
30	DTT	natural abundance	10 mM
31	CaCL2	natural abundance	5 mM
32	NaCL	natural abundance	200 mM
33	MES pH 6.5	natural abundance	20 mM
34	D2O	natural abundance	5 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013

Referencing offset: -0.2 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013

Referencing offset: -0.2 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013

Referencing offset: -0.07 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013

Referencing offset: -0.69 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2M1L, Strand ID: A, B Detail

Release date

2013-01-23

Citation

Solution NMR Structure of CDK2-associated protein 2 (CDK2AP2; Deleted in Oral Cancer 1 Related protein, DOC-1R)
Ertekin, A., Janjua, H., Shastry, R., Pederson, K., Prestegard, J.H., Montelione, G.T.
Not known

Related entities 1. HR8910C, : 1 : 3 : 13 entities Detail

Interaction partners 1. HR8910C, : 17 interactors Detail

More details for 17 interactors identified by 3 citations

Experiments performed 17 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

2 2D 1H-13C HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

3 3D HNCO

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

4 3D CBCA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

5 3D HNCACB

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

6 3D CBCA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

7 3D HBHA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

8 3D HN(CA)CO

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

9 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

10 3D 1H-15N NOESY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

11 3D 13C-filtered NOESY aliphatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, 15.0 mg/mL natural abundance HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
9	HR8910C	[U-100% 13C; U-100% 15N]	5.0 mg/mL
10	HR8910C	natural abundance	15.0 mg/mL
11	NaN3	natural abundance	0.02 %
12	DTT	natural abundance	10 mM
13	CaCL2	natural abundance	5 mM
14	NaCL	natural abundance	200 mM
15	MES pH 6.5	natural abundance	20 mM
16	D2O	natural abundance	5 %
17	Proteinase Inhibitors	natural abundance	1 na

12 2D 13C-filtered NOESY aromatic

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
9	HR8910C	[U-100% 13C; U-100% 15N]	5.0 mg/mL
10	HR8910C	natural abundance	15.0 mg/mL
11	NaN3	natural abundance	0.02 %
12	DTT	natural abundance	10 mM
13	CaCL2	natural abundance	5 mM
14	NaCL	natural abundance	200 mM
15	MES pH 6.5	natural abundance	20 mM
16	D2O	natural abundance	5 %
17	Proteinase Inhibitors	natural abundance	1 na

13 2D 1H-13C high res (L/V methyl stereospecific assignment)

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-5%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
27	HR8910C.005	[U-5% 13C; U-100% 15N]	5.0 mg/mL
28	Proteinase Inhibitors	natural abundance	1 na
29	NaN3	natural abundance	0.02 %
30	DTT	natural abundance	10 mM
31	CaCL2	natural abundance	5 mM
32	NaCL	natural abundance	200 mM
33	MES pH 6.5	natural abundance	20 mM
34	D2O	natural abundance	5 %

14 3D HC(C)H-TOCSY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

15 3D HC(C)H-COSY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

16 3D (H)CCH-TOCSY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

17 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5.0 mg/mL [U-100%13C; U-100% 15N] HR8910C, pH 6.5 buffer

#	Name	Isotope labeling	Concentration
1	HR8910C.003	[U-100% 13C; U-100% 15N]	5.0 mg/mL
2	Proteinase Inhibitors	natural abundance	1 na
3	NaN3	natural abundance	0.02 %
4	DTT	natural abundance	10 mM
5	CaCL2	natural abundance	5 mM
6	NaCL	natural abundance	200 mM
7	MES pH 6.5	natural abundance	20 mM
8	D2O	natural abundance	5 %

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_18869_2m1l.nef
Input source #2: Coordindates	2m1l.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--60-------70--------80--------90-------100-------110-------120------
SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
--------10--------20--------30--------40--------50--------60---------

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

--60-------70--------80--------90-------100-------110-------120------
SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
--------10--------20--------30--------40--------50--------60---------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	69	0	0	100.0
B	B	69	0	0	100.0

Content subtype: combined_18869_2m1l.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	711		98.6 (chain: A, length: 69)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	Warning	2467 (1)	noe	95.7 (chain: A, length: 69), 95.7 (chain: B, length: 69)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_3	OK	202 (202)	.	76.8 (chain: A, length: 69), 76.8 (chain: B, length: 69)
1	RDC restraints	CNS/XPLOR_dipolar_coupling_4	OK	82 (82)	.	59.4 (chain: A, length: 69), 59.4 (chain: B, length: 69)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 69, Sequence coverage: 98.6%
- Total number of assignments
  - ¹H chemical shifts: 363
  - ¹³C chemical shifts: 283
  - ¹⁵N chemical shifts: 65
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	408	361	88.5
¹³C chemical shifts	299	283	94.6
¹⁵N chemical shifts	76	65	85.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	140	136	97.1
¹³C chemical shifts	138	135	97.8
¹⁵N chemical shifts	66	64	97.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	268	225	84.0
¹³C chemical shifts	161	148	91.9
¹⁵N chemical shifts	10	1	10.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	39	37	94.9
¹³C chemical shifts	39	37	94.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	12	12	100.0
¹³C chemical shifts	12	12	100.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 69, Sequence coverage: 95.7%
  - Entity_assembly_ID: B, Chain length: 69, Sequence coverage: 95.7%
- Total number of restraints: 2467
- Weight of restraints: 1.0 (2467)
- Potential type of restraints: square-well-parabolic (2467)
- Range of distance target values: 2.18, 3.92 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 69, Sequence coverage: 76.8%
  - Entity_assembly_ID: B, Chain length: 69, Sequence coverage: 76.8%
- Total number of restraints: 202
- Total number of restraints per polymer type: 202
- Weight of restraints: 1.0 (202)
- Potential type of restraints: square-well-parabolic (202)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A
  - Chain_ID: B

RDC restraints

Saveframe: CNS/XPLOR_dipolar_coupling_4

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 69, Sequence coverage: 59.4%

--60-------70--------80--------90-------100-------110-------120------
SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
              || || ||||| | |||| ||||||||| |||||| |||||  || |||||    
..............ST.TD.LSVIE.M.KEIR.TYAGSKSAM.RLKRGI.HARAL..EC.AETER    
--60-------70--------80--------90-------100-------110-------120--

Entity_assembly_ID: B, Chain length: 69, Sequence coverage: 59.4%

--60-------70--------80--------90-------100-------110-------120------
SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
              || || ||||| | |||| ||||||||| |||||| |||||  || |||||    
..............ST.TD.LSVIE.M.KEIR.TYAGSKSAM.RLKRGI.HARAL..EC.AETER    
--60-------70--------80--------90-------100-------110-------120--

Total number of restraints: 82
Potential type of restraints: undefined (82)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None
- Chain_ID: B
  None

Keywords NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein NMR, Protein Structure Initiative, Structural Genomics, Target HR8910C

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.86 seconds)

BMRB: 18869

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. HR8910C, : 1 : 3 : 13 entities Detail

Interaction partners 1. HR8910C, : 17 interactors Detail

Experiments performed 17 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail