Solution structure of hypothetical protein lmo0427
MKRKIIAVTA CATGVAHTYM AAQALKKGAK KMGNLIKVET QGATGIENEL TEKDVNIGEV VIFAVDTKVR NKERFDGKVV LEVPVSAPIK DAEKVINAAL ALIDEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.6 % (1182 of 1211) | 97.4 % (610 of 626) | 97.5 % (462 of 474) | 99.1 % (110 of 111) |
Backbone | 99.5 % (629 of 632) | 99.1 % (215 of 217) | 100.0 % (311 of 311) | 99.0 % (103 of 104) |
Sidechain | 96.2 % (652 of 678) | 96.6 % (395 of 409) | 95.4 % (250 of 262) | 100.0 % (7 of 7) |
Aromatic | 93.8 % (30 of 32) | 93.8 % (15 of 16) | 93.8 % (15 of 16) | |
Methyl | 97.4 % (152 of 156) | 98.7 % (77 of 78) | 96.2 % (75 of 78) |
1. entity
MKRKIIAVTA CATGVAHTYM AAQALKKGAK KMGNLIKVET QGATGIENEL TEKDVNIGEV VIFAVDTKVR NKERFDGKVV LEVPVSAPIK DAEKVINAAL ALIDEKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7, Details pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7, Details pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7, Details pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7, Details pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7, Details pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7, Details pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Listeria monocytogenes EGD-e | [U-95% 13C; U-95% 15N] | 1.2 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | sodium chloride | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18887_2m1z.nef |
Input source #2: Coordindates | 2m1z.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL ------ ALIDEK |||||| ALIDEK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_18887_2m1z.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL ------ ALIDEK |||||| ALIDEK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 626 | 609 | 97.3 |
13C chemical shifts | 474 | 462 | 97.5 |
15N chemical shifts | 114 | 112 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 217 | 214 | 98.6 |
13C chemical shifts | 212 | 212 | 100.0 |
15N chemical shifts | 104 | 103 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 409 | 395 | 96.6 |
13C chemical shifts | 262 | 250 | 95.4 |
15N chemical shifts | 10 | 9 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 78 | 96.3 |
13C chemical shifts | 81 | 75 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 15 | 93.8 |
13C chemical shifts | 16 | 15 | 93.8 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL ------ ALIDEK |||||| ALIDEK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAAL |||||||| ||||||||||||||||||| |||||||| ||||||| |||||||| |||||| |||||||||||||||||||||| ...KIIAVTAC..GVAHTYMAAQALKKGAKKM.NLIKVETQ.........TEKDVNI.EVVIFAVD..VRNKER....VVLEVPVSAPIKDAEKVINAAL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ ALIDEK || AL --