NMR structure of the RRM2 domain of the protein RBM10 from homo sapiens
QAQGVLASQA LSQGSEPSSE NANDTIILRN LNPHSTMDSI LGALAPYAVL SSSNVRVIKD KQTQLNRGFA FIQLSTIEAA QLLQILQALH PPLTIDGKTI NVEFAKGSKR DMASNEGSRI SAASVASTAI A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.0 % (1214 of 1446) | 82.6 % (615 of 745) | 84.7 % (472 of 557) | 88.2 % (127 of 144) |
Backbone | 86.6 % (672 of 776) | 88.6 % (234 of 264) | 83.9 % (324 of 386) | 90.5 % (114 of 126) |
Sidechain | 81.5 % (647 of 794) | 78.4 % (377 of 481) | 87.5 % (258 of 295) | 66.7 % (12 of 18) |
Aromatic | 84.8 % (39 of 46) | 87.0 % (20 of 23) | 82.6 % (19 of 23) | |
Methyl | 92.0 % (160 of 174) | 92.0 % (80 of 87) | 92.0 % (80 of 87) |
1. entity
QAQGVLASQA LSQGSEPSSE NANDTIILRN LNPHSTMDSI LGALAPYAVL SSSNVRVIKD KQTQLNRGFA FIQLSTIEAA QLLQILQALH PPLTIDGKTI NVEFAKGSKR DMASNEGSRI SAASVASTAI ASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D20 | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18905_2m2b.nef |
Input source #2: Coordindates | 2m2b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTI -------110-------120-------130- NVEFAKGSKRDMASNEGSRISAASVASTAIA ||||||||||||||||||||||||||||||| NVEFAKGSKRDMASNEGSRISAASVASTAIA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 131 | 0 | 0 | 100.0 |
Content subtype: combined_18905_2m2b.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTI |||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GVLASQALSQGSEP....ANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130- NVEFAKGSKRDMASNEGSRISAASVASTAIA |||||||||||||| ||| |||||||| NVEFAKGSKRDMAS....RIS.ASVASTAI -------110-------120-------130
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
90 | HIS | ND1 | 210.15 |
110 | ARG | HH21 | 4.845 |
110 | ARG | HH22 | 8.389 |
110 | ARG | NH2 | 70.01 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 745 | 604 | 81.1 |
13C chemical shifts | 557 | 446 | 80.1 |
15N chemical shifts | 149 | 122 | 81.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 264 | 230 | 87.1 |
13C chemical shifts | 262 | 195 | 74.4 |
15N chemical shifts | 126 | 110 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 481 | 374 | 77.8 |
13C chemical shifts | 295 | 251 | 85.1 |
15N chemical shifts | 23 | 12 | 52.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 80 | 89.9 |
13C chemical shifts | 89 | 78 | 87.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 20 | 87.0 |
13C chemical shifts | 23 | 19 | 82.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTI ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GVLASQALSQGSE.....ANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130- NVEFAKGSKRDMASNEGSRISAASVASTAIA ||||||||| ||| ||| ||||| NVEFAKGSK..MAS....RIS..SVAST -------110-------120--------