1H, 13C and 15N resonance assignments of an N-terminal domain of CHD4
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.0 % (856 of 1007) | 90.1 % (475 of 527) | 78.3 % (306 of 391) | 84.3 % (75 of 89) |
Backbone | 86.2 % (436 of 506) | 85.5 % (148 of 173) | 87.3 % (220 of 252) | 84.0 % (68 of 81) |
Sidechain | 85.4 % (496 of 581) | 92.4 % (327 of 354) | 74.0 % (162 of 219) | 87.5 % (7 of 8) |
Aromatic | 45.7 % (43 of 94) | 87.2 % (41 of 47) | 0.0 % (0 of 45) | 100.0 % (2 of 2) |
Methyl | 98.6 % (71 of 72) | 100.0 % (36 of 36) | 97.2 % (35 of 36) |
1. CHD4
GPLGSSKEPK SSAQLLEDWG MEDIDHVFSE EDYRTLTNYK AFSQFVRPLI AAKNPKIAVS KMMMVLGAKW REFSTNNPFK GSSGASSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHD4 | [U-100% 13C; U-100% 15N] | 350 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | D2O | natural abundance | 5 % | |
5 | DSS | natural abundance | 0.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18906_2n5n.nef |
Input source #2: Coordindates | 2n5n.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
140-----150-------160-------170-------180-------190-------200-------210-------220----- GPLGSSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGAS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGAS --------10--------20--------30--------40--------50--------60--------70--------80------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 86 | 0 | 0 | 100.0 |
Content subtype: combined_18906_2n5n.nef
Assigned chemical shifts
140-----150-------160-------170-------180-------190-------200-------210-------220----- GPLGSSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGAS || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || .PL...KEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFK....AS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 527 | 476 | 90.3 |
13C chemical shifts | 391 | 306 | 78.3 |
15N chemical shifts | 92 | 74 | 80.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 173 | 147 | 85.0 |
13C chemical shifts | 172 | 143 | 83.1 |
15N chemical shifts | 81 | 67 | 82.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 354 | 329 | 92.9 |
13C chemical shifts | 219 | 163 | 74.4 |
15N chemical shifts | 11 | 7 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 37 | 92.5 |
13C chemical shifts | 40 | 37 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 40 | 85.1 |
13C chemical shifts | 45 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
140-----150-------160-------170-------180-------190-------200-------210-------220----- GPLGSSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGAS | |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..L...KEPKSSAQLLEDWGMEDI.HVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFK 140-----150-------160-------170-------180-------190-------200-------210---------