Solution NMR structure of the N-terminal domain of STM1478 from Salmonella typhimurium LT2: Target STR147A of the Northeast Structural Genomics consortium (NESG), and APC101565 of the Midwest Center for Structural Genomics (MCSG).
MGSSHHHHHH SSGRENLYFQ GHAATELTPE QAAALKPYDR IVITGRFNAI GDAVSAVSRR ADEEGAASFY VVDTSEFGNS GNWRVVADVY KA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 72.3 % (722 of 998) | 73.2 % (372 of 508) | 70.7 % (278 of 393) | 74.2 % (72 of 97) |
Backbone | 74.8 % (410 of 548) | 74.7 % (142 of 190) | 75.0 % (201 of 268) | 74.4 % (67 of 90) |
Sidechain | 70.8 % (378 of 534) | 72.3 % (230 of 318) | 68.4 % (143 of 209) | 71.4 % (5 of 7) |
Aromatic | 42.9 % (48 of 112) | 50.0 % (28 of 56) | 34.5 % (19 of 55) | 100.0 % (1 of 1) |
Methyl | 86.7 % (78 of 90) | 86.7 % (39 of 45) | 86.7 % (39 of 45) |
1. entity
MGSSHHHHHH SSGRENLYFQ GHAATELTPE QAAALKPYDR IVITGRFNAI GDAVSAVSRR ADEEGAASFY VVDTSEFGNS GNWRVVADVY KASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.5 mM | |
2 | BIS-TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | benzamidine | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18917_2m2j.nef |
Input source #2: Coordindates | 2m2j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90- MGSSHHHHHHSSGRENLYFQGHAATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEFGNSGNWRVVADVYKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGHAATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEFGNSGNWRVVADVYKA --------10--------20--------30--------40--------50--------60--------70--------80--------90--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_18917_2m2j.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90- MGSSHHHHHHSSGRENLYFQGHAATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEFGNSGNWRVVADVYKA |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| .....................HAATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEF..SGNWRVVADVYKA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 508 | 346 | 68.1 |
13C chemical shifts | 393 | 262 | 66.7 |
15N chemical shifts | 103 | 67 | 65.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 190 | 133 | 70.0 |
13C chemical shifts | 184 | 129 | 70.1 |
15N chemical shifts | 90 | 63 | 70.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 318 | 213 | 67.0 |
13C chemical shifts | 209 | 133 | 63.6 |
15N chemical shifts | 13 | 4 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 38 | 82.6 |
13C chemical shifts | 46 | 38 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 23 | 41.1 |
13C chemical shifts | 55 | 14 | 25.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90- MGSSHHHHHHSSGRENLYFQGHAATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEFGNSGNWRVVADVYKA |||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| .......................ATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEF..SGNWRVVADVYKA
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90- MGSSHHHHHHSSGRENLYFQGHAATELTPEQAAALKPYDRIVITGRFNAIGDAVSAVSRRADEEGAASFYVVDTSEFGNSGNWRVVADVYKA ||||| ||||||||| ||||||| |||||||||||||||| ||||||||| ||||||||| ......................AATEL.PEQAAALKP.DRIVITG....IGDAVSAVSRRADEEG.ASFYVVDTS.......WRVVADVYK 0--------10--------20--------30--------40--------50--------60--------70--------80--------90