Solution structure of Ph1500: a homohexameric protein centered on a 12-bladed beta-propeller
EGVIMSELKL KPLPKVELPP DFVDVIRIKL QGKTVRTGDV IGISILGKEV KFKVVQAYPS PLRVEDRTKI TLVTHPVDVL EAKIKGIKDV ILDENLIVVI TEENEVLIFN QNLEELYRGK FENLNKVLVR NDLVVIIDEQ KLTLIRT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 46.0 % (1738 of 3780) | 45.9 % (904 of 1970) | 46.5 % (694 of 1494) | 44.3 % (140 of 316) |
Backbone | 46.5 % (847 of 1820) | 46.8 % (288 of 616) | 46.4 % (422 of 910) | 46.6 % (137 of 294) |
Sidechain | 45.8 % (1032 of 2254) | 45.5 % (616 of 1354) | 47.0 % (413 of 878) | 13.6 % (3 of 22) |
Aromatic | 29.8 % (50 of 168) | 29.8 % (25 of 84) | 29.8 % (25 of 84) | |
Methyl | 49.8 % (243 of 488) | 49.6 % (121 of 244) | 50.0 % (122 of 244) |
1. Ph1500
EGVIMSELKL KPLPKVELPP DFVDVIRIKL QGKTVRTGDV IGISILGKEV KFKVVQAYPS PLRVEDRTKI TLVTHPVDVL EAKIKGIKDV ILDENLIVVI TEENEVLIFN QNLEELYRGK FENLNKVLVR NDLVVIIDEQ KLTLIRT2. Ph1500N
MHHHHHHEGV IMSELKLKPL PKVELPPDFV DVIRIKLQGK TVRTGDVIGI SILGKEVKFK VVQAYPSPLR VEDRTKITLV THP3. Ph1500C
MHHHHHHVDV LEAKIKGIKD VILDENLIVV ITEENEVLIF NQNLEELYRG KFENLNKVLV RNDLVVIIDE QKLTLIRTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ph1500C | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 250 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Ph1500N | [U-100% 15N] | 1.0 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 50 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | Ph1500 | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
22 | sodium phosphate | natural abundance | 20 mM | |
23 | sodium chloride | natural abundance | 250 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Ph1500N | [U-100% 15N] | 1.0 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 50 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Ph1500N | [U-100% 15N] | 1.0 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 50 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker DMX - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Ph1500N | [U-100% 15N] | 1.0 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 50 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker DMX - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Ph1500N | [U-100% 15N] | 1.0 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 50 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker DMX - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Ph1500N | [U-100% 15N] | 1.0 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 50 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ph1500C | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 250 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ph1500C | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 250 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ph1500C | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 250 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ph1500C | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 250 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ph1500C | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 250 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | Ph1500 | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
22 | sodium phosphate | natural abundance | 20 mM | |
23 | sodium chloride | natural abundance | 250 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 353 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ph1500C | [U-85% 2H; U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 250 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Ph1500N | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18978_2m3x.nef |
Input source #2: Coordindates | 2m3x.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT -------110-------120-------130-------140-------
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT -------110-------120-------130-------140-------
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT -------110-------120-------130-------140-------
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT -------110-------120-------130-------140-------
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT -------110-------120-------130-------140-------
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT -------110-------120-------130-------140-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 147 | 0 | 0 | 100.0 |
B | B | 147 | 0 | 0 | 100.0 |
C | C | 147 | 0 | 0 | 100.0 |
D | D | 147 | 0 | 0 | 100.0 |
E | E | 147 | 0 | 0 | 100.0 |
F | F | 147 | 0 | 0 | 100.0 |
Content subtype: combined_18978_2m3x.nef
Assigned chemical shifts
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||| .GVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVT.PVDVLEAKIKGIKDVILDENLIVVI -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||| ||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKF.NLNKVLVRNDLVVIIDEQKLTLIRT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 942 | 883 | 93.7 |
13C chemical shifts | 712 | 674 | 94.7 |
15N chemical shifts | 158 | 131 | 82.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 294 | 279 | 94.9 |
13C chemical shifts | 294 | 270 | 91.8 |
15N chemical shifts | 140 | 128 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 648 | 604 | 93.2 |
13C chemical shifts | 418 | 404 | 96.7 |
15N chemical shifts | 18 | 3 | 16.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 123 | 121 | 98.4 |
13C chemical shifts | 123 | 121 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 25 | 83.3 |
13C chemical shifts | 30 | 25 | 83.3 |
Distance restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ||||||||| ||||| .GVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLV...VDVLEAKI.GIKDVILDE.LIVVI -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||| ||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKF.NLNKVLVRNDLVVIIDEQKLTLIRT
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||| | ||||||||||||| || || | | | | ||||||| | | | | | | | | | | | || | | ||||| .....SELKLK.L.......DFVDVIRIKLQGK.VR.GD.I.I.I..K.VKFKVVQ.Y...L.V....K.T.V....D.L.A.I.G.KD.I.D..LIVVI ------------10--------20--------30--------40--------50--------60--------70--------80--------90------ -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT || ||||||| | | | || ||| | | |||||| | | | TE.NEVLIFN...E..Y.G.FE.LNK.L.R..LVVIID..K.T.I -100-------110-------120-------130-------140-
Dihedral angle restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVI -100-------110-------120-------130-------140--- TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT ||||||||||||||||||||||||||||||||||||||||||||||| TEENEVLIFNQNLEELYRGKFENLNKVLVRNDLVVIIDEQKLTLIRT