1H, 13C, and 15N Chemical Shift Assignments for the C-terminus of the minichromosome maintenance protein MCM from Sulfolobus solfataricus
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS43:SG | 1:CYS83:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.1 % (995 of 1025) | 96.1 % (521 of 542) | 99.0 % (391 of 395) | 94.3 % (83 of 88) |
Backbone | 97.5 % (505 of 518) | 96.1 % (171 of 178) | 98.4 % (251 of 255) | 97.6 % (83 of 85) |
Sidechain | 97.1 % (571 of 588) | 96.2 % (350 of 364) | 100.0 % (221 of 221) | 0.0 % (0 of 3) |
Aromatic | 100.0 % (20 of 20) | 100.0 % (10 of 10) | 100.0 % (10 of 10) | |
Methyl | 100.0 % (96 of 96) | 100.0 % (48 of 48) | 100.0 % (48 of 48) |
1. C-terminus of the minichromosome maintenance protein MCM
GSHMGESGKI DIDTIMTGKP KSAREKMMKI IEIIDSLAVS SECAKVKDIL KEAQQVGIEK SNIEKLLTDM RKSGIIYEAK PECYKKVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
6 | potassium phosphate | natural abundance | 10 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium azide | natural abundance | 0.05 w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
6 | potassium phosphate | natural abundance | 10 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
6 | potassium phosphate | natural abundance | 10 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
6 | potassium phosphate | natural abundance | 10 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
6 | potassium phosphate | natural abundance | 10 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.05 w/v |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | C-terminus of the minichromosome maintenance protein MCM | [U-100% 13C; U-100% 15N] | 700 uM | |
6 | potassium phosphate | natural abundance | 10 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium azide | natural abundance | 0.05 w/v |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18986_2m45.nef |
Input source #2: Coordindates | 2m45.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:642:CYS:SG | A:682:CYS:SG | oxidized, CA 53.666, CB 44.081 ppm | oxidized, CA 56.964, CB 48.015 ppm | 2.037 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
600-----610-------620-------630-------640-------650-------660-------670-------680------ GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV --------10--------20--------30--------40--------50--------60--------70--------80-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 87 | 0 | 0 | 100.0 |
Content subtype: combined_18986_2m45.nef
Assigned chemical shifts
600-----610-------620-------630-------640-------650-------660-------670-------680------ GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 542 | 531 | 98.0 |
13C chemical shifts | 395 | 391 | 99.0 |
15N chemical shifts | 90 | 82 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 178 | 175 | 98.3 |
13C chemical shifts | 174 | 170 | 97.7 |
15N chemical shifts | 85 | 82 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 364 | 356 | 97.8 |
13C chemical shifts | 221 | 221 | 100.0 |
15N chemical shifts | 5 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 53 | 100.0 |
13C chemical shifts | 53 | 53 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 10 | 100.0 |
13C chemical shifts | 10 | 10 | 100.0 |
Covalent bonds
Distance restraints
600-----610-------620-------630-------640-------650-------660-------670-------680------ GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MGE.GKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV
600-----610-------620-------630-------640-------650-------660-------670-------680------ GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV || ||| | |||||||||||||||||| | |||||||||||| |||||||||||||||| | | || | ...........ID.IMT.K.KSAREKMMKIIEIIDSLA.....A.VKDILKEAQQVG..KSNIEKLLTDMRKSGI.Y....E.YK.V
Dihedral angle restraints
600-----610-------620-------630-------640-------650-------660-------670-------680------ GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV ||||||||||||||||||| |||||||||||| | | || |||||||| ||||||| |||||||||||||||||||||||||| ..HMGESGKIDIDTIMTGKPK..REKMMKIIEIID.L.V..EC.KVKDILKE.QQVGIEK.NIEKLLTDMRKSGIIYEAKPECYKKV